KEGG   Gallus gallus (chicken): 374209
Entry
374209            CDS       T01006                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3 precursor
  KO
K06493  integrin beta 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
gga04810  Regulation of actin cytoskeleton
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    374209 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    374209 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    374209 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    374209 (ITGB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    374209 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    374209 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    374209 (ITGB3)
   04515 Cell adhesion molecules [BR:gga04515]
    374209 (ITGB3)
   04090 CD molecules [BR:gga04090]
    374209 (ITGB3)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    374209 (ITGB3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   374209 (ITGB3)
Cell adhesion molecules [BR:gga04515]
 Integrins
  Integrin beta subunits
   374209 (ITGB3)
CD molecules [BR:gga04090]
 Proteins
  374209 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 EGF_2 PSI_integrin RNA_pol_A_CTD
Other DBs
NCBI-GeneID: 374209
NCBI-ProteinID: NP_989646
CGNC: 223
Ensembl: ENSGALG00000000379
UniProt: Q92071
Position
27
AA seq 781 aa
MEELRVAFSILVLCAAGSWGSNICATRGVTSCKQCLAVSPLCAWCSAEVVAQSTPRCDLF
ANLLQNGCGRDFIEFPRSSITVLEERPLSDKGSGGSTTTQMSPQRIQLNLRPDDSQMFRV
HVRQVEDYPVDIYYLMDLSNSMKDDLKNIQNLGTKLASEMRKLTSNLRIGFGAFVDKPIS
PYMYISPPEAIKNPCYEIGEKCLPMFGYKHVLTLTDEVMRFNEEVKKQSVSRNRDAPEGG
FDAIIQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDAQCHIDKDNFYS
ASTTLDYPSLGLMTEKLSQKNINLIFAVTDTVVGLYQNYSELIPGTTVGTLSRDSSNVLQ
LIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNDEVITGLKSCMGLKIGDTVSFSIEAK
VRGCPQERQKSFTIKPVGFKDSLTVVVNFDCNCSCESQAEANSSFCSKGNGSLECGVCRC
NPGRLGSHCECSEEEYNPSEQDNCSPQPGQPLCSQRGECICGQCVCHGSDFGKVTGKYCE
CDDFSCVRFKGQMCSGHGQCSCGDCLCDSDWTGDYCNCTTRTDTCMSSNGLVCSGHGICV
CGKCDCIQPGSYGNTCEKCPTCSDACTIKKECVECKKYERGTLVEQQSCGRVCRDEIETV
QELGDRGKDAVNCTYKDENDCVVRFQYYEDSSGKSILYVIEEPECPKGPDILVVLLSVMG
AILLIGLAALLIWKLLITIHDRREFARFEEEKARAKWDTGNNPLYKEATSTFTNITYRGN
M
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggaggaactccgcgtcgctttcagcatcctggtgctctgcgctgctggcagctggggg
agtaacatctgcgctacccgaggggtgacctcctgcaagcagtgcctggccgtcagcccc
ctctgtgcatggtgctctgcagaggtggtggcacagtcgaccccacgttgcgacctgttt
gccaacctcctgcagaacggctgcgggagggacttcattgagtttcccaggagcagcatc
acagtcctggaggagcggccgctcagtgataagggctcaggggggtccaccaccacccaa
atgagcccccagaggatccagctgaacctgcggccagatgactcccaaatgttccgtgtc
cacgtgcgccaagtggaagactaccctgtggacatctactacctgatggacctgtccaac
tccatgaaggacgatctgaagaacatccagaacctgggtaccaagctggccagtgagatg
cgcaagctcaccagcaaccttcgcatcggctttggggcctttgtggacaagcccatttcc
ccttacatgtacatctctcctccagaagccatcaagaacccttgctatgagattggggaa
aagtgcttgcccatgtttggatacaaacatgtcctgacgctcacggacgaggtgatgcgc
ttcaacgaggaggtgaagaagcagagcgtctcacggaacagggatgcacccgagggtggc
tttgatgccatcatccaggccaccgtgtgtgatgagaaaattggctggaggaacgacgca
tcccacctgctggtcttcaccacggacgccaagacacacatcgcactggatggcagactg
gctggcattgtgcagcccaatgatgctcagtgccacattgacaaggataacttctactca
gcttccaccacgctggactatccctctctgggcctgatgactgagaagctctcacagaag
aacatcaatttgatctttgctgtgacagatacggttgttggtctctaccagaattacagt
gagctgatcccaggcacaactgtgggcaccttgtccagagactccagcaatgtcctgcag
ctcattgtggacgcctacgggaaaatccgctccaaggtagaactggaggtgcgtgacctt
cctgaagagctgtccctgtccttcaatgccacctgcctcaatgacgaggtcatcactggg
ctcaagtcctgcatggggctcaagattggggacacggtgagcttcagcatcgaggccaag
gtgcgaggctgcccacaggagcgtcagaaatccttcaccatcaaacctgtgggcttcaag
gacagcttgaccgtggtggtgaactttgactgcaactgttcctgcgagagccaggccgag
gccaacagctccttctgcagcaaaggcaatggcagcctggagtgcggggtgtgccgctgc
aacccggggcgcctgggctcacactgcgagtgctcagaggaggagtacaacccctcagag
caggacaactgcagcccacagccaggacagcccctctgcagccagcgtggcgagtgcatc
tgtgggcagtgtgtgtgccatggcagtgactttggcaaggtgacgggcaagtactgtgag
tgcgacgacttctcctgtgtccgcttcaaaggccagatgtgctcagggcacgggcagtgc
agctgcggagactgcctgtgtgactcagactggactggtgactactgcaactgcaccacg
cgcacggacacctgcatgtccagcaatgggctggtgtgcagcggccacggcatctgcgtc
tgtggcaagtgtgactgcatccagcctggctcctatgggaacacctgcgagaagtgtcct
acgtgctcggatgcctgtaccatcaaaaaggaatgcgtggagtgcaagaagtatgagcgg
ggcacgctggtggagcagcagtcctgtggccgcgtgtgccgtgatgagattgagacagtg
caggagctgggtgacaggggcaaggatgctgtgaactgcacctacaaggatgagaatgac
tgcgtggtgcgcttccagtactacgaggactccagtggcaaatccatcctctatgtcata
gaggagccagagtgcccgaaggggccagacatcctggtggtgctgctctcagtgatgggt
gccatcctgctcatcggcctggctgccctgctcatctggaaactcctcatcaccatccac
gaccgccgggagttcgcccgcttcgaggaggagaaggccagggccaagtgggacacaggc
aacaacccattatacaaagaggcaacctcaaccttcaccaacatcacataccgtgggaac
atgtag

DBGET integrated database retrieval system