KEGG   Gallus gallus (chicken): 374212Help
Entry
374212            CDS       T01006                                 

Gene name
ADORA1
Definition
(RefSeq) adenosine receptor A1
  KO
K04265  adenosine receptor A1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    374212 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    374212 (ADORA1)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    374212 (ADORA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx UPF0182
Motif
Other DBs
NCBI-GeneID: 374212
NCBI-ProteinID: NP_989647
CGNC: 91
Ensembl: ENSGALG00000000168
UniProt: P49892
Position
26
AA seq 324 aa AA seqDB search
MAQSVTAFQAAYISIEVLIALVSVPGNILVIWAVKMNQALRDATFCFIVSLAVADVAVGA
LVIPLAIIINIGPQTEFYSCLMMACPVLILTESSILALLAIAVDRYLRVKIPVRYKSVVT
PRRAAVAIACCWIVSFLVGLTPMFGWNNLNKVLGTRDLNVSHSEFVIKCQFETVISMEYM
VYFNFFVWVLPPLLLMLLIYLEVFNLIRTQLNKKVSSSSNDPQKYYGKELKIAKSLALVL
FLFALSWLPLHILNCITLFCPSCKTPHILTYIAIFLTHGNSAMNPIVYAFRIKKFRTAFL
QIWNQYFCCKTNKSSSSSTAETVN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtccgtgacggctttccaggctgcctacatctccatcgaagtgctgatcgct
ttggtgtcggtgccggggaatatcctggtcatctgggctgtgaagatgaaccaggcgctg
cgggatgccactttctgcttcatcgtctcgctggcggtggccgacgtggctgtgggggct
ctggtcatccctttggccatcatcatcaatatcggaccgcagacggagttctacagctgc
ctcatgatggcgtgccccgtcctcatcctcaccgagagctccatcctggctctcctggcc
atcgctgtggatcggtacctgcgagtgaagatcccggtcaggtataagagcgtggtgaca
ccccggcgagcagcagtggccatcgcctgctgttggatcgtctcctttctggtgggactc
accccaatgttcggttggaataacctgaacaaggtgctggggactcgggatctgaatgtc
agccactcggagtttgtcatcaagtgccaattcgagacggtcatcagcatggagtacatg
gtgtacttcaacttcttcgtctgggtcctgccgcccctgctgctgatgctgctcatctac
ctggaagtcttcaacctcatccgcacgcagctcaacaagaaggtctcctccagctccaac
gacccccagaagtattacgggaaggagctgaagatcgccaagtccctcgcgctggttctc
ttcctctttgcgctcagctggctccctctgcacatcctcaactgcatcactttgttctgc
ccatcctgcaagacaccgcacatcctcacctacatcgccatcttcctcacccatggcaac
tcggctatgaaccccattgtctacgccttcaggatcaagaagttccggacagccttcctg
cagatctggaaccagtatttctgctgcaaaaccaacaaaagcagcagcagcagcacagct
gagacggtcaactaa

DBGET integrated database retrieval system