KEGG   Gallus gallus (chicken): 374231
Entry
374231            CDS       T01006                                 
Symbol
FOXO1
Name
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04218  Cellular senescence
gga04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    374231 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    374231 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    374231 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374231 (FOXO1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    374231 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 374231
NCBI-ProteinID: NP_989659
CGNC: 49093
Ensembl: ENSGALG00000017034
UniProt: Q9W7F9
Position
1:171900263..171963540
AA seq 727 aa
MGGRVAAAAAAEGEEPGRAAGPEPRGREPRGSRRPRRRGRADPRSEPAWGGGAEPLRCPP
LLPAVPLLPAVPLPPAAAMAEAPQLVDIDPDFEPLPRPRSCTWPLPRPEFNPPSSATSSP
APSCGGQPDGAAAAGAAVAVAASGALSADFISNLCLVEESEDFALPPAAAAPPESAACRC
GDFSAPEAGCRLHPPGPPPVPPVPPAVAALSPGPVAGQPRKSSSSRRNAWGNLSYADLIT
KAIESSPEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEG
TGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGNGDSPGS
QFSKWPASPSSHSNDDFDNWSTFRPRTSSNASTISGRLSPILPEQDDLGDGDVHSMVYPS
SATKMTSTLPSLSEMSSSENMENLLDNLNLLSPNTSMTVSTQSSSAALMQQTPGYSFASS
TTSICSPNPDYRKFTYAQASMNSLPQIPMQTLQDSKSSYGSMSQFNCPAGLLKELLTSDS
PPHNDILASVDTGVSQAGGRALGQGVLMVTNSVMPTYGNQPPHNKMMNPNARPHQGHNQP
TPAVNGRALSHTVNPMSHTSCLNRLSTVKTSLQVPMSHQMQMNAMNPYAPVNSCNGYGRV
GIVSLHQEKLPSDLDDMLIERLDCDMESIIRNDLMDGETLDFNFDSVLPNQSFQHSVKTT
THSWVSG
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgggcggccgggtcgctgctgccgccgccgccgagggcgaggagccgggtagggcggcg
gggccggagccgcggggtcgagagccgagagggagtcggcggccgcgccgtcggggccgc
gccgatccgcgctcggagcctgcatggggcggcggtgctgagccgctccgctgccccccg
ctgctccccgccgtcccgctgctccccgccgtcccgctgccccccgccgccgccatggcc
gaggccccgcagctggtggacatcgaccccgacttcgagccgctgccgcggccccgctcg
tgcacctggcccctgccgcggccggagttcaacccgcccagctcggccacctccagcccc
gcgccgtcctgcggagggcaacccgacggggcggccgcggccggagcagccgtcgccgtc
gccgcctccggggcgctgagcgccgacttcatcagcaacctctgcctggtggaggagagc
gaggacttcgcgctgccccccgccgccgccgcccccccggagtcggccgcctgccgctgc
ggggacttctcggcgcccgaggccggctgccgcctgcacccgccgggaccgccgccggtg
ccgccggtacctccggccgtggccgcgctgtcgccgggccccgtggccgggcagccccgc
aagagcagctcgtcgcgccgcaacgcctggggtaacctgtcctacgcggacctcatcacc
aaggccatcgagagctcccccgagaagaggctcaccctctcccagatctacgagtggatg
gtcaagagcgtgccctacttcaaggataagggcgacagcaacagttcagccggttggaag
aattcgatccgtcacaacttgtccctgcacagcaaattcatcagagtgcagaatgaggga
acagggaagagttcctggtggatgctcaatcctgaaggaggaaagagtggcaagtctcct
aggaggcgagcagcatccatggataacaacagcaagtttgcaaaaagcagaggcagagca
gccaagaaaaaagcatctcttcaatctggtcaggagggaaatggtgacagccctggatct
cagttctcaaagtggcctgcaagccccagctctcacagtaatgatgactttgataactgg
agtacatttcgacctagaactagctctaatgctagtacaattagtggaagactttctcct
attttgccagagcaagatgatcttggagatggggatgtgcactccatggtatacccatca
tcagccaccaaaatgacttctactctacccagcctttcagagatgagtagttcagagaac
atggaaaatcttttggataaccttaatcttttgtcacctaatacgtcaatgactgtatca
acccagtcgtcatctgctgccctgatgcagcaaacaccaggttactcatttgcatcttca
acaacaagtatatgttcaccaaatccagactacaggaaatttacgtatgctcaagctagc
atgaactctttgccccaaattcctatgcagactctccaagacagtaaatcaagctatgga
tcgatgagccaatttaactgtcctgcaggacttttgaaggagttactgacttctgattct
cctccgcataatgatatcttggcatcagtagacactggtgtttcccaggctggtggcagg
gcgctgggccaaggtgtactgatggtcactaattcagtgatgccaacttatggcaatcag
ccacctcacaacaaaatgatgaaccctaacgcccgtcctcaccaaggacataaccagcca
acacctgcagttaatggccgtgccttgtcacacacagtgaaccccatgtcacatacttca
tgtctaaatcgcttgtcgacagtgaagacttcattacaagtgcctatgagtcaccagatg
cagatgaatgctatgaacccgtatgcccctgttaacagttgcaacggctacggaagggtg
ggaattgtttccctccaccaggagaagcttcccagtgacttagatgacatgttaattgaa
cggttggactgtgacatggagtcgattattcgtaatgaccttatggatggagaaacgtta
gattttaactttgacagtgtattgcctaaccaaagttttcagcacagcgtaaagacaacc
acacacagttgggtgtcaggctag

DBGET integrated database retrieval system