KEGG   Gallus gallus (chicken): 374237Help
Entry
374237            CDS       T01006                                 

Gene name
CBX1
Definition
(RefSeq) chromobox protein homolog 1
  KO
K11585  chromobox protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    374237 (CBX1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Heterochromatin formation proteins
   HP1 (heterochromatin protein 1)
    374237 (CBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo_shadow Chromo Mtf2_C CDC45
Motif
Other DBs
NCBI-GeneID: 374237
NCBI-ProteinID: NP_989663
CGNC: 49096
Ensembl: ENSGALG00000033926
UniProt: O93480
Position
27
AA seq 185 aa AA seqDB search
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQSQKTAHESEKSEGSKRKAESDTEDKGEESKPKKKKEESEKPRGFARGFEPE
RIIGATDSSGELMFLMKWKNSDEADLVPAKEANIKCPQVVISFYEERLTWHSYPSEDDDK
KEDKN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaacagaacaagaagaaagtggaagaggtcttagaggaagaggaggaggag
tatgtggtggagaaggtcctggatcgacgggtggtgaagggcaaagtggaatatctgctg
aaatggaaaggcttctccgatgaagataacacatgggagccagaggagaacctcgactgc
ccagacctcattgcagagttccttcagtctcagaaaactgcacatgagagtgagaagtct
gagggaagcaaacgcaaagcagaatctgacacagaagacaaaggggaggagagcaaacca
aagaagaagaaggaggagtcggagaaaccacgaggctttgcccggggctttgagccagaa
cggatcattggtgccacagattccagcggggagctcatgttcctgatgaagtggaagaac
tctgatgaggccgacctggtccccgccaaggaagccaacatcaagtgcccccaggtggtc
atctcgttctatgaggagaggttgacatggcattcctacccctcagaggacgatgacaag
aaagaggacaagaactaa

DBGET integrated database retrieval system