KEGG   Gallus gallus (chicken): 374243
Entry
374243            CDS       T01006                                 
Symbol
WNT2B
Name
(RefSeq) protein Wnt-2b precursor
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374243 (WNT2B)
   04150 mTOR signaling pathway
    374243 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    374243 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    374243 (WNT2B)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   374243 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 374243
NCBI-ProteinID: NP_989667
CGNC: 49099
Ensembl: ENSGALG00000034196
UniProt: Q98SN7 A0A1D5NX70
Position
26:3495150..3506642
AA seq 385 aa
MLSPNRLAASPGIAVAPGRAECGAFPRTAGAAPRICLPFVLILLALTPRADSSWWYIGAL
GARVICDNIPGLVNKQRQLCQRYPDIMQSVGEGAKEWIRECQYQFRHHRWNCSTLDRDHT
VFGRVMLRSSREAAFVYAISSAGVVYAITRACSQGELKACGCDPLKRGRAKDERGEFDWG
GCSDNINYGIRFAKAFVDAKEKKVKDARALMNLHNNRCGRMAVKRFLKLECKCHGVSGSC
TLRTCWLAMSDFRKTGDYLRKKYNGAIQVIMNQDGTGFTVANKNFRKPTKTDLVYFENSP
DYCVMDKSAGSLGTAGRVCNKVSRGTDGCEVMCCGRGYDTTRVTRVTKCECKFHWCCAVR
CKECEDTVDVHTCKAPKRAEWLDQT
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgctcagtccaaaccgcctggcagcgtctcctgggattgccgtggcccccgggcgtgcg
gagtgcggagcgttccctcggacggcgggcgcggccccgcggatttgccttcccttcgtg
ctcatcctgctcgccctgacgccccgcgccgactcctcgtggtggtacatcggggcgctg
ggggcgagggtgatctgcgacaacatcccggggctggtgaacaagcagaggcagctgtgc
cagaggtaccccgacatcatgcagtccgtcggggagggagccaaggagtggatccgtgag
tgccagtaccaattccgtcaccaccgctggaactgcagcaccctggaccgggaccacacc
gtcttcgggagggtgatgctgcgaagcagcagggaggccgccttcgtctacgccatctcc
tcggccggggtggtgtacgccatcacgcgcgcctgcagccaaggggagctgaaggcctgc
ggctgtgacccactgaagcgcggccgggccaaggatgagcgcggggagttcgactggggc
ggctgcagcgacaacatcaactacggcatccgcttcgccaaagccttcgtggatgccaag
gagaagaaagtgaaggacgcgcgggcgctgatgaacctgcacaacaaccgctgcggcagg
atggctgtgaagcgcttcctgaagctggagtgcaaatgccatggggtcagcggctcctgc
acgctaaggacttgttggctggccatgtcggatttccggaaaacgggggattacctgcgg
aagaaatacaatggggccatccaggtgatcatgaaccaggacggtaccggcttcaccgtg
gccaacaagaacttcaggaagcccacgaagacagacctggtgtattttgagaactcacct
gactactgcgtgatggacaagtcagcaggctcactgggcaccgcagggcgcgtgtgcaac
aaggtctcccgcggcacggatggctgcgaagtgatgtgctgcgggcgggggtacgacacc
acccgcgtcacccgcgtcaccaagtgtgagtgcaagttccactggtgctgcgctgtgcgc
tgcaaggagtgcgaggacactgtggatgtgcacacgtgtaaagcgcccaaaagggccgag
tggttggaccagacctga

DBGET integrated database retrieval system