KEGG   Gallus gallus (chicken): 374249
Entry
374249            CDS       T01006                                 

Gene name
GDF5
Definition
(RefSeq) growth/differentiation factor 5 precursor
  KO
K04664  growth differentiation factor 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    374249 (GDF5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    374249 (GDF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    374249 (GDF5)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   374249 (GDF5)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 374249
NCBI-ProteinID: NP_989669
CGNC: 1254
Ensembl: ENSGALG00000038355
UniProt: Q9W6G0
Position
20
AA seq 500 aa
MKILHFLTLLLWHLTWLSLDRVPGALSNSEAGQSNPGSKTDLLKAEGKERTASARSGAPR
AANHGFSTGTSKARAKSNAAQAGALLAKNDESQRVLSRTAVTEAKVGHLPSRPSAVRTVT
PKVPNLGSKAALKKTGTGGTDASSFKTKKTKEPVTQREAKETFSRPPITPHEYMLSLYRT
LSDAERKGVNGSVKLEAGLANTITSFIDKGQDERAPTIRKQKYIFDISALEKDGLLVAEL
RILRKNPSDTWKSHSSGKTSQVKLFSCSTNRQAATLLDSRTVSITDTPKWEVFDIWKLFR
NFKNLVNLCFELETFDRGRAVDLRTVGFNRTGRQVNEKALFLVFGRTKKRDLFFNEIKAR
SGQDDKTVYEYLFNQRRKRRAPLATRQGKRPSKNLKPRCSRKALHVNFKDMGWDDWIIAP
LEYEAYHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDS
ANNVVYKQYEDMVVESCGCR
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaaaatcctgcattttctcactttactgctttggcatttgacttggctgtctctggat
cgtgttcctggagcactgagtaactccgaagcaggccagagtaatccagggtctaaaaca
gatctgttaaaagcagaaggaaaagagaggactgcctcagcacggtcgggcgcgccgcgg
gctgcgaaccatggatttagcaccgggacctcgaaggcgagggctaaaagcaacgctgct
caggctggagctctgctggccaagaacgatgaatcacagagggttctttcaagaacagca
gtcacagaggcaaaggtaggacatctcccgagcagaccttctgcagtaaggacggtgact
ccaaaggtcccaaatcttggcagcaaggcggctctgaagaaaactggcacgggcggcact
gatgccagctccttcaaaacgaagaagactaaagagcctgtgacccaaagggaagctaag
gaaaccttcagcaggccccctataacgccacatgaatacatgctctctttgtacaggact
ctctcagatgcagaaagaaaaggtgttaatggaagtgtaaaactggaggctggactcgcc
aatacaataaccagctttatagacaagggacaagatgagcgagcgccaaccataagaaaa
caaaaatatatttttgacatcagtgcattagaaaaagatggcctgctggtagcagagctt
cgaatactgaggaaaaatccttctgatacgtggaagtctcattcttctggaaaaacttcc
caggtgaaattatttagttgctctaccaacagacaagcagcaacactgctggactctcgt
accgtcagtatcacggacacaccaaaatgggaagtgtttgacatctggaagctttttagg
aactttaaaaacttggttaacttgtgtttcgaactggaaacttttgacagggggagagcg
gttgatctcaggactgtgggatttaacagaacgggaagacaggtcaacgaaaaggctctc
ttcttggtatttgggaggacaaagaaaagggacttatttttcaatgaaatcaaagctaga
tccggccaggacgacaaaaccgtgtatgagtacttattcaatcagaggcggaagagaaga
gctcctctggcaacacgccaagggaagaggcccagtaagaacctgaagccaaggtgtagc
agaaaagccctccatgtgaattttaaggacatgggctgggatgactggataatagcaccc
ctggaatacgaagcgtatcactgcgaaggtctgtgtgagttccccctccgatcccacctg
gagcccaccaatcacgccgttatccaaactttaatgaactcaatggaccccgaatcaacg
cctccaacttgctgtgtcccaaccaggctgagtcctatcagcattctcttcattgactct
gcaaacaatgtggtctacaagcagtacgaggacatggtggtggagtcgtgtggctgcagg
tag

DBGET integrated database retrieval system