KEGG   Gallus gallus (chicken): 374271
Entry
374271            CDS       T01006                                 

Gene name
IGFBP4
Definition
(RefSeq) insulin-like growth factor-binding protein 4 precursor
  KO
K23576  insulin-like growth factor-binding protein 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    374271 (IGFBP4)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    374271 (IGFBP4)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 374271
NCBI-ProteinID: NP_989684
CGNC: 49112
Ensembl: ENSGALG00000040672
UniProt: Q801D7
Position
27
AA seq 260 aa
MCGAAVLLLAAAAAAAAAAAGPGGGGEEATQCPPCSEERLARCKAPQGCTESVREPGCGC
CATCALGRGTACGVYTARCGAGLRCYPPRGVPRPLHTLMHGQGVCTDLADVEAIQESLQP
PEKEEIEHPNNSFSPCSIHDRKCLQKQQAKRINNGNKMRSSGSPHHREESRPIAQGSCQS
ELHRALERLAASQTRTHEDLYVIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVK
LPGFLELKGDLDCHQPADSM
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtgcggggccgccgtgctgctgctggcggcggcggcggcggcggcggcggcggcggcg
gggccggggggcggcggggaggaggcgacccagtgcccgccgtgctcggaggagcggcta
gcccgctgcaaggccccgcagggctgcaccgagtcggtgcgggagccgggctgcggctgc
tgcgcgacctgcgcgctcggccggggcaccgcctgcggggtgtacacggcgcgctgcggg
gccgggctgcgctgctacccgccccgcggagtgccccggccgctgcacaccctcatgcac
gggcagggcgtctgcaccgacctggccgacgtcgaggccatccaggagagcctgcagcca
ccagagaaggaggagatcgagcaccccaacaacagcttcagcccctgcagcatccacgac
cgcaagtgcctgcagaagcagcaggcaaagcgcatcaacaacggcaataaaatgcgcagc
agtggaagcccacatcaccgcgaggagagccggcccattgcacagggctcgtgtcagagc
gagctgcaccgcgcgctggagcgactggcggcctcacagacacggacacacgaggatctc
tacgtcatccccatccccaactgcgaccgcaacggcaacttccaccccaagcagtgtcac
ccggcgctggatgggcagcggggcaagtgctggtgcgtggaccgcaagacgggggtgaag
ctgccgggcttcctggagctgaagggggacttggattgccaccagccagcggacagcatg
tga

DBGET integrated database retrieval system