KEGG   Gallus gallus (chicken): 374273
Entry
374273            CDS       T01006                                 

Gene name
SURF4
Definition
(RefSeq) surfeit locus protein 4
  KO
K20369  ER-derived vesicles protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    374273 (SURF4)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    374273 (SURF4)
SSDB
Motif
Pfam: SURF4 DoxX
Other DBs
NCBI-GeneID: 374273
NCBI-ProteinID: NP_989686
CGNC: 66188
Ensembl: ENSGALG00000028265
UniProt: Q800K9
Position
17
AA seq 269 aa
MGQNDIMSTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDGTWN
CGYFLASIFVFINLFGQLSGCILVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN
LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDMNFF
YILQNIVGTALIILVAIGFKTKLAALTLVIWLFGINIYFNAFWTIPAYKPMHDFLKYDFF
QTMSVIGGLLLVVALGPGGVSMDEKKKEW
NT seq 810 nt   +upstreamnt  +downstreamnt
atgggtcagaacgatatcatgagcaccgctgaggacttcgcggatcagttcctgagggtg
acgaagcagtacctcccccacgtggcccgcctgtgcctgatcagcaccttcctggaggat
ggcatccgcatgtggttccagtggagcgaacagagggattacattgatggaacgtggaac
tgtggctatttcctagcctccatctttgtgttcataaatctcttcggacagctgagcggc
tgtatcctggtgctgagtaggaactttgtgcaatatgcctgctttggactgtttggaatt
atagcattacagactattgcatacagcattctatgggacctgaagttcttgatgaggaac
cttgccctggggggaggcttgctactacttttggctgagtcacgctcagaggggaagagc
atgtttgctggtgtccctactatgcgggagagctctcctaagcagtacatgcagcttggg
ggccgtgtgctgctggtcctcatgttcatgacactgctgcattttgatatgaacttcttt
tatattctgcaaaacattgtaggcacagccctgattatcttggtggcaattggcttcaag
acgaagctggctgccttgactctagtcatctggctgtttggcatcaacatctacttcaat
gccttctggaccatcccagcctacaagcccatgcacgacttcctcaaatatgatttcttc
cagaccatgtctgtaattggagggctcctccttgtggttgcactgggtcctggtggagtc
tccatggatgagaagaagaaagagtggtaa

DBGET integrated database retrieval system