KEGG   Gallus gallus (chicken): 378779
Entry
378779            CDS       T01006                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2 precursor
  KO
K21283  bone morphogenetic protein 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    378779 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    378779 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    378779 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    378779 (BMP2)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   378779 (BMP2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   378779 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 378779
NCBI-ProteinID: NP_989689
CGNC: 49116
Ensembl: ENSGALG00000029301
UniProt: Q6XDQ0
Position
3
AA seq 392 aa
MVAATRSLLALLLCRVLLGGAAGLMPEVGRRRFSEPGRAASAAQRPEDLLGEFELRLLHM
FGLKRRPSPGKDVVIPPYMLDLYRLHAGQQLGYPLERAASRANTVCSFHHEEVLEELPET
SGKTARRFFFNLTSIPNEESVTSAELQIFREQVHEAFESNSSYHHRINIYEIMKPATATS
KDPVTRLLDTRLVHHNASKWESFDVTPAVLRWIAHGQPNHGFVVEVVHLDKENSASKRHV
RISRSLHQDEDSWSQLRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRHKYSCKRHPLYVD
FNDVGWNDWIVAPPGYSAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPT
ELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggttgccgccacccgctccctcctggcgctgctgctctgccgggtgctgctgggcggc
gcggccggcctcatgccggaggtgggacggcggcgcttcagcgaaccgggccgcgccgcc
tcggccgcgcagcgccccgaggacctcctgggcgagttcgagctgcgcctgctccacatg
ttcgggctgaagcggcggccgagccccggcaaggacgtcgtcatccccccctacatgttg
gacctctatcgcctgcacgccggccagcagctgggctacccgctggagagggccgccagc
cgcgccaacaccgtgtgcagcttccaccacgaagaagttttggaagaactgccagaaaca
agtgggaaaacagcacgacgtttcttctttaatttaacttccatccctaatgaggagtct
gtcacctcagctgaactccagatttttcgggagcaggtgcacgaagcctttgagagcaac
agcagctaccatcaccgtattaatatttatgaaattatgaagccagccacagccacctcc
aaggaccctgtcacgagacttttggacaccaggttggtgcatcataatgcaagtaaatgg
gaaagttttgatgtaacgccagctgttttgaggtggattgcacacggacaacctaaccat
gggtttgtggtggaggtggttcacttggacaaagagaacagtgcctccaagaggcacgtt
aggattagcaggtctttacatcaggatgaagatagctggtctcagctcaggccgttgtta
gtgacgtttgggcatgatggcaagggacacccgctccacaaaagagaaaagcgtcaagcg
aaacacaaacagcgtaagcgccacaaatacagttgcaaaaggcatccgttgtatgtggac
ttcaatgacgtggggtggaatgactggattgttgccccgccggggtacagtgccttttac
tgccatggggaatgtccttttccgctggcagatcacctaaactcaacaaaccatgccatt
gttcagactttggtcaattcggtgaattccaaaatccccaaggcttgctgtgtgccgaca
gaactgagtgctatctcaatgctctaccttgatgagaacgaaaaggtcgtactaaagaac
tatcaagatatggttgtggagggctgcgggtgccgctga

DBGET integrated database retrieval system