KEGG   Gallus gallus (chicken): 378786
Entry
378786            CDS       T01006                                 

Gene name
SIX3
Definition
(RefSeq) homeobox protein SIX3
  KO
K19473  homeobox protein SIX3/6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    378786 (SIX3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, SIM
    378786 (SIX3)
SSDB
Motif
Pfam: SIX1_SD Homeodomain Homeobox_KN HTH_3 Homez
Other DBs
NCBI-GeneID: 378786
NCBI-ProteinID: NP_989695
CGNC: 49119
Ensembl: ENSGALG00000032259
UniProt: O42406
Position
3
AA seq 314 aa
MVFRSPLELYPTHFFLPNFAADPHHRSLLLASGGSGSGSGCSPGAGGGGGSSRAPHEELS
MFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVV
AFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP
LPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR
QRDRAAAAKNRLQHQAIGQSGMRSLAEPGCPTHSSAESPSTAASPTTSVSSLTERAETGT
SILSVTSSDSECDV
NT seq 945 nt   +upstreamnt  +downstreamnt
atggtgttcaggtccccgctagagctctatcccacccatttcttcctgcccaacttcgcc
gccgacccgcaccaccgctccctccttctcgccagcggcggcagcggcagcggctcgggc
tgcagccccggggccggcggcggcggcggcagctcccgggcgccccacgaagagttgtca
atgtttcagctgcccacgctcaacttctccccggagcaagtggccagcgtctgcgagacg
ctggaggagaccggagacatagagaggctggggaggttcctctggtcgctgccggtggcg
ccgggggcatgcgaggccatcaacaagcacgagtccatcctgcgcgcccgggcggtggtg
gccttccacacgggcaacttccgcgacctctaccacatcctggagaaccacaaattcacc
aaggagtcgcacggcaagctgcaggccatgtggctcgaagcgcactaccaggaggccgag
aagctgcggggccgcccgctggggccggttgataaatacagggtgaggaagaagtttccg
ctgcccaggaccatttgggatggcgagcagaagacgcactgcttcaaggagaggactcgc
agcctcctgagggagtggtacctgcaggacccttaccccaatccgagcaagaaaagggaa
ctggctcaggccacggggctcacccccacgcaagtaggcaactggttcaaaaaccgaagg
caaagagacagagcggcggcggctaaaaacaggctccagcaccaggcgataggacagagc
ggcatgcggtcgttggcagagcccggctgcccgacgcacagctcggccgagtccccgtcc
acggcggccagcccgaccaccagcgtctccagtttgacagaaagagccgagacgggcacc
tccatcctctcggtaacctccagcgactcggaatgtgatgtatga

DBGET integrated database retrieval system