KEGG   Gallus gallus (chicken): 378788Help
Entry
378788            CDS       T01006                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6 precursor
  KO
K02376  frizzled 6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    378788 (FZD6)
   04150 mTOR signaling pathway
    378788 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    378788 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    378788 (FZD6)
G protein-coupled receptors [BR:gga04030]
 Frizzled / Smoothened family
  378788 (FZD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Folate_rec DUF3664 LapA_dom
Motif
Other DBs
NCBI-GeneID: 378788
NCBI-ProteinID: NP_001258860
CGNC: 49120
Ensembl: ENSGALG00000030626
UniProt: Q9PTW1 Q6WJ02
Position
2
AA seq 709 aa AA seqDB search
MGVLAFFVPYSFLLTVVRGHSLFTCEPITISRCSRMPYNMTFFPNIMGHYDQDTAALQME
PFLTLMNLHCSPDVHTFLCKAFVPACLEQVHVIHPCRNLCEKVYSDCKQLIDTFGITWPE
ELECSRLVNCDETAPATAPVTTNAHGTQKTPGQTRRDYGFWCPRHLHTSNGQGYKFLGID
QCAPPCPNMYFKNYELDVAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSV
CYSIVSLMYFIGFLLGNRTACNKADDKLEIGETVVLGSQNKACTVLFMVLYFFTMAGTIW
WVILTITWFLAAGRKWSCEAIAQKAMWFHAVAWGIPGFLTIMLLAMNKVEGDNISGVCFV
GLYDVDASLYFVLLPLCLCVFFGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGV
FSGLYLVPLVALLGCYVYELVNRKIWETTWVFDHCDQYHIPCPYQAKALARPEIFLFLMK
YLLTLIVGISPVFWVGSKKTCSEWANFFNRNRKRDPISESRRVLQESCEFFLRHNSKVKH
KKKHYKSSSHRLKVISKSMGTSTGGTTNHGTSAVAITNHDYLSQETVAEIKTSPETSEKE
MEADGTSAQKAEEGENSGNQMLSVSKLTVDQVEKRNKADSTCDMSSLSESLKRIGEGRVS
PRNDLIESPPLQSSSSQIADVSQSGSVSLLVYSAADGRKEMESGNSSNH
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcttgcgttcttcgtgccttatagttttcttctgactgtagtgcgagggcac
agcttgttcacgtgtgaaccgattactatttccaggtgttcaagaatgccttacaatatg
acttttttcccaaatatcatgggacactatgatcaggacactgctgcgctccagatggag
ccttttcttactcttatgaatcttcactgttcaccagacgtccatacatttctgtgcaaa
gcctttgttcctgcctgcctggagcaagttcacgtgattcacccttgtcgtaacctctgt
gagaaggtgtattccgattgcaaacaactgattgacacttttggaatcacgtggcctgaa
gagctggaatgtagcagactagtcaattgtgatgagactgctcctgccactgctcctgta
accaccaacgcacatggaactcagaagaccccagggcagacacgaagggattatggattc
tggtgtccacgacacctacacacttccaatggacaaggctacaaatttctgggcatcgat
cagtgtgcaccaccgtgtcccaatatgtacttcaaaaattatgaattggatgttgcgaaa
agcttcattggaatagtttcaatcttttgtctttgtgctacacttttcacattccttact
tttctgattgatgttaaaaggtttaggtacccagagaggccaatcatatattactctgtc
tgttacagcatagtgtctctaatgtactttattggatttcttcttgggaatagaactgcc
tgtaacaaggcagatgataagctagaaattggggaaacggttgttcttggctcccaaaac
aaagcctgcacggtccttttcatggttttgtactttttcactatggcaggaacaatatgg
tgggtgattctgacaatcacttggttccttgcagcaggaagaaaatggagttgtgaagct
attgcacaaaaggccatgtggttccatgcagttgcatgggggatacctggttttctaacc
attatgcttcttgcaatgaacaaagtggaaggggacaatatcagcggagtttgttttgta
ggtctctatgatgtggatgcctctctgtactttgtgcttttgccattatgcctttgtgtt
tttttcggtctctctcttctattagctggtattatctctttaaatcatgtgcggcaagtc
atacagcacgatggcagaaaccaagagaagctaaagaaatttatgatcagaattggagtt
tttagtggtttatacttagtgccacttgtggcacttcttggatgttatgtctatgaactg
gtgaacaggaagatctgggaaacaacttgggtgtttgaccactgtgaccagtaccacatt
ccttgtccctaccaggcaaaggcactagcaagaccagaaatatttctgtttctgatgaaa
tatttgctgacattaattgttggcatatctccagtgttctgggtgggaagtaaaaagacc
tgttcggaatgggccaatttcttcaacagaaaccgcaagagagatcccatcagtgagagc
cgaagagtactgcaagaatcatgcgaatttttcttgaggcacaattccaaagttaagcat
aagaagaagcactacaaatcgagttcgcacagattgaaagtaatttccaagtcaatggga
actagcacaggtggcacaacaaatcatggaacttctgcagtagcaatcaccaatcacgat
tacctgagccaggaaactgttgcagaaattaaaacttctccagagacatctgagaaagag
atggaggcggacggaacatcagcccaaaaagctgaggaaggtgaaaacagtggaaatcaa
atgttaagtgttagcaaactgaccgtggatcaggtggaaaaaagaaacaaagcagacagc
acgtgtgatatgagtagcttgtctgagagcctgaagagaattggtgaaggcagggtatct
cccaggaacgatttgattgaatctcctccattacaaagcagcagctctcaaatagcggac
gtctcccagtcgggctccgtatcgctgctggtctactcggccgcagacggcaggaaggag
atggaatcagggaacagttcaaaccattga

DBGET integrated database retrieval system