KEGG   Gallus gallus (chicken): 378903
Entry
378903            CDS       T01006                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform 1
  KO
K09052  cAMP response element modulator
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    378903 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    378903 (CREM)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    378903 (CREM)
SSDB
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 378903
NCBI-ProteinID: NP_001265061
CGNC: 49136
Ensembl: ENSGALG00000007082
UniProt: A0A3Q2U5F9
Position
2
AA seq 294 aa
MTKCAKKHDKTAGRRMTMEMVESQQDDNAVDSMSDRDAVHNRSQPDKREISSVSQVASIA
DDSAESEEITDTQKRREILSRRPSYRKILNELSSDTPAIPRIEEEKSEEEGAGISPLSMP
SSLYHSSTGQFIAITPGGTIQISSPPSDGAQGLQTLTMTNSGTPQPGATIVQYTAQSSDG
TQQFFVPGSQLVVQAATGDMPSYQLRTPTTNLPQGVVMAASPGALHSPQQLAEEATRKRE
LRLMKNREAAKECRRRKKEYIKCLESRVAVLEVQNQKLIEELETLKDICSSKTD
NT seq 885 nt   +upstreamnt  +downstreamnt
atgactaagtgtgccaagaaacacgacaaaacagctgggagacggatgaccatggaaatg
gttgaatcgcaacaggatgataacgcagtggattctatgtcagatagagacgctgttcac
aatcgcagtcagccagacaagcgtgagatttcctcagtatctcaggtagcatcgattgca
gacgactctgcagaatcagaagagataactgatactcaaaaacgtagggaaatactttca
agaaggccttcataccgaaaaattttgaatgaactctcttcagatactcctgcaatccca
aggattgaagaagaaaagtcagaagaagaaggagctggaatttctccactgtccatgcca
agcagcctgtatcactctagcacagggcaattcattgctataactccaggtggtacaatc
cagatttctagtccaccttctgatggtgcccagggactgcagacgttaacaatgacaaat
tcaggaactcctcagccgggtgctaccattgtgcaatacacagcacagtcatctgatggt
acacaacagttttttgttcctggaagccaacttgttgttcaagctgccactggagacatg
ccatcttaccagcttcggactcccactactaacttacctcagggagtggtaatggcagcc
tccccaggggctctgcatagtcctcagcaactggcagaagaggcaacgcgcaagagagag
ctgcgacttatgaaaaacagggaagctgctaaagaatgtcgacgtcggaagaaagaatac
ataaaatgtctggagagtcgtgttgcagtgctagaagttcagaaccagaaacttatagag
gagcttgaaacccttaaagacatttgctcttccaaaacagattag

DBGET integrated database retrieval system