KEGG   Gallus gallus (chicken): 378917
Entry
378917            CDS       T01006                                 
Symbol
FGF9
Name
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    378917 (FGF9)
   04020 Calcium signaling pathway
    378917 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    378917 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    378917 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    378917 (FGF9)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   378917 (FGF9)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   378917 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 378917
NCBI-ProteinID: NP_989730
CGNC: 66190
Ensembl: ENSGALG00000025748
UniProt: Q7ZZN4
Position
1:complement(179687260..179717135)
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPALPADSPVLLSDHLGQAEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRQDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPEKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcctctcggggaggttgggaactatttcggtgtgcaggacgcggtgccctttggg
aacgtgcccgcgctgccggcggacagcccggttttgctcagtgaccacctgggccaggct
gaggcaggtgggctgcccaggggccccgcggtcacggacttggaccatttaaaggggatc
ctcaggaggaggcagctctactgcaggactggatttcatttagaaatcttccccaatggt
actatccagggcaccaggcaagaccacagccgattcggtatactggagttcatcagtata
gcagtgggcctggtcagcatccgaggagtagacagcggactctaccttggaatgaatgag
aaaggggagctctacggctcggaaaaattaacccaggagtgtgtattcagagagcagttt
gaagaaaactggtataacacatattcatcaaatctatataaacacgtggacactggaaga
cgatactacgtggcgttaaataaagatggaactccaagagaagggactaggactaaacgg
catcaaaaatttacacattttttacctagaccagtggaccctgagaaagtacctgaacta
tataaggatattttaagccaaagttga

DBGET integrated database retrieval system