KEGG   Gallus gallus (chicken): 386574Help
Entry
386574            CDS       T01006                                 

Gene name
NFKB2
Definition
(RefSeq) nuclear factor NF-kappa-B p100 subunit
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    386574 (NFKB2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    386574 (NFKB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    386574 (NFKB2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    386574 (NFKB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_3 Ank Ank_4 Ank_5 Death
Motif
Other DBs
NCBI-GeneID: 386574
NCBI-ProteinID: NP_989744
CGNC: 49153
Ensembl: ENSGALG00000005653
UniProt: P98150
Position
6
AA seq 907 aa AA seqDB search
MDEHFQPCLDGIDYDDFSFGSHMVEQKEPLMETAVGPYLVIIEQPKQRGFRFRYGCEGPS
HGGLPGASSEKGHKTYPTVKICNYEGMARIEVDLVTHSDPPRVHAHSLVGKQCNEAGNCV
AIVGPKDMTAQFSNLGVLHVTKKNMMEIMKEKLKKQKTRNTNGLLTEAELREIELEAKEL
KKVMDLSIVRLRFTAYLRDSSGNFTLALQPVISDPIHDSKSPGASNLKISRMDKTAGSVR
GGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKPKIDR
PVTVFLQLKRKRGGDVSDSKQFTYYPVVEDKEEVERKRKKVLPQFPQHFGGGSHMGGAGG
AGGFGAGGGGNLSFPYSSGLGYNNLYSSSPHPVGGGYQGGVQMKAASESGDGDDRQAPTE
STYCRELQRHAHLCHLWLLARRNAHALLDYSVTADPRMLLAVQRHLAASQDENGDTPLHL
AIIHEQTAVIKQLIEVVVSIPSQQIINITNNLQQTPLHLAVITKQPQVVQLLLQAHANPT
LLDRYGNSLLHLALQAADEEMLRMLLAHLGSATPYLLHLPNFQGLLPVHLAVKAKSPACL
DLLVRKGADVNGVERQGGRTPLHLAVEMENLNMATHLVKKLGANVNSRTFAGNAPLHLAA
GLGSPTLTKLLLKAGADVQRENDEPVSPSSSEASSDTDGDPEEQEQEQAMELGEPALSPH
PTPEEEQEEAGPRQRRCHTALDLTRSQKVRDILLQASQPRPDTELPTTPRAGNVLSLDSD
ALQGLEQLLNQDGSGSDWMELAKRLGLCSLVETYKDTPSPSVSLLRSYELAGGSLGGLLE
ALDSMGLRGAVRMLRKPEPLEKLQSTEVKEDSAYGSESVEEEQAAALKPRPVPEGELPHS
QQQQQVH
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcacttccagccctgcctggatgggattgactacgatgacttcagcttcggc
tcgcacatggtggagcagaaggagcccctgatggagacagcagtcgggccctacctggtc
atcatcgagcagccgaagcagcggggcttccgatttcggtatggctgcgagggcccttct
cacggggggctgccaggcgcctccagcgagaaggggcacaagacctatcccaccgtcaag
atctgcaactacgaggggatggcgcgcatcgaggtggacctggtgacgcacagcgaccct
ccgcgtgtgcacgcgcacagcctggtgggcaagcagtgcaacgaggccggcaactgcgtc
gccatcgtggggcccaaagacatgacggcacagttcagcaacctgggtgtgctccacgtc
accaagaagaacatgatggagatcatgaaggagaagctgaagaagcagaagacgcgcaac
acaaatgggctgctgacagaagctgagctgcgtgagatcgagctggaggccaaggagctg
aagaaggtgatggacctgagcatcgtgcggctgcgcttcaccgcttacctccgtgacagc
agtgggaacttcactctggcactacagcccgtcatctctgaccccatccatgacagcaag
tcccccggcgcttccaacctgaagatctcgcggatggacaagactgcgggctcagtgcgg
ggtggggacgaggtgtacctgctgtgcgacaaggtgcagaaagatgacattgaggtgcgg
ttctatgaggacgacgagaacggctggcaggccttcggggacttctcccccacggacgta
cacaagcagtacgccatcgtcttccgcacgcccccctaccacaagcccaaaattgaccgt
cctgtcaccgtgttcctgcaactgaagcggaagcgcggtggggacgtcagcgactccaag
cagttcacctattaccctgtggtggaggataaggaggaggtggagcggaagcgcaagaag
gtgctgcctcagtttccccagcacttcggcgggggctcacacatggggggtgccggcggt
gctgggggctttggggcaggaggaggcggtaacctcagctttccttactcatctggactg
ggctacaacaacctctactcctccagcccgcaccctgtggggggtgggtaccagggcggc
gtgcagatgaaggctgccagcgagagcggggatggagatgacagacaggcgcccacagaa
agtacctattgcagggagctgcagcggcacgcccacttgtgccacctgtggctgctggca
cgccgcaacgcccatgccctgctggactactcggtgactgctgacccccgcatgctgctg
gccgtgcagaggcacctggctgcctcgcaggatgagaatggggacacgcccttgcacctc
gccatcatccatgagcagacggctgtgatcaagcagctaattgaggtggtggtcagcatc
cctagccagcagatcattaacatcaccaacaacttgcagcagacgccactgcacctggcg
gtcatcaccaagcagccccaggtggtgcagctcctgctgcaggcccacgccaaccccacc
ctgctggaccgctacggcaactccctgctgcacctggcactgcaggcggctgatgaggag
atgctgcggatgctgctggcccacctgggctcggccactccctacctgctgcacctgccc
aacttccagggtctcctgcccgtacacctggctgtgaaggcgaagagcccggcctgcttg
gacctgctggtcaggaagggtgcggatgtgaacggcgtggagaggcagggtggcaggacc
ccgctgcacctggccgtggagatggagaacctcaacatggccacgcacctggtgaagaag
ctgggagcaaatgtcaacagccggacctttgccgggaacgcccccctgcacctggctgcc
ggcctgggctccccaaccctcaccaaactgctgcttaaagcaggggcagatgtgcagcgt
gagaacgatgagcccgtcagcccctcctcgtcagaggccagcagcgacacggatggcgac
cccgaggagcaggagcaggagcaggccatggagctgggagagccggctctgagcccccat
cccacccccgaggaggagcaggaggaggcggggccccggcagcgccgctgccacacagcc
ctggacctgacccggagccagaaggtgcgggacatcctgctgcaggcctcccagccgcgc
cccgatactgagctgcccaccaccccccgggcagggaacgtgctgtctctggacagcgat
gcgctgcaggggctggagcagctgctgaatcaggacggcagcgggtcggactggatggag
ctggccaagaggctggggctctgcagccttgtggagacctacaaggacaccccttcgccc
agcgtcagcctgctgcgcagctacgagctggccgggggcagccttggggggctgctggag
gctctggactccatggggctgcgcggagctgtcagaatgctgcgcaaacccgagccgctg
gagaagctgcagagcacagaggtcaaggaagacagtgcctatgggagcgagtcggtggag
gaggagcaggcggccgccctgaagccgaggccggtgccagagggcgagctgccccacagc
cagcagcagcagcaggtgcactga

DBGET integrated database retrieval system