KEGG   Gallus gallus (chicken): 386580
Entry
386580            CDS       T01006                                 

Gene name
PTPRC
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase C precursor
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    386580 (PTPRC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    386580 (PTPRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    386580 (PTPRC)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    386580 (PTPRC)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     386580 (PTPRC)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    386580 (PTPRC)
CD molecules [BR:gga04090]
 Proteins
  386580 (PTPRC)
SSDB
Motif
Pfam: Y_phosphatase fn3 Y_phosphatase3 PTPlike_phytase DSPc CBP_BcsO
Other DBs
NCBI-GeneID: 386580
NCBI-ProteinID: NP_989748
CGNC: 1563
Ensembl: ENSGALG00000002192
UniProt: A0A1D5PR76
Position
8
AA seq 1237 aa
MFLCLKLLAFGVAFLCQDAFAQAGNDNLTSASSLSSTLPTPTRSTSFSPPSTTAGVQPAS
TGASPTASTHLSTHSGSGPTTGLGHLQHSSPAALTTRTLTAFHQTVSDYYSSTSLHNTTS
PVITPASTETIPTSTIESTTTTEEPCDNSIDYGNIEEKNNSAEVTLKNLKENRIYDILLE
DGKSLSVNASNNIVMLNWCRRYTVQSRSCKVMYLTIPPDEKRYTFGAKSIGNDNATLRLN
SLCIDCEDVCSNVTVSCKTNSINSGGTGNLTGSYELMKHDINADNITILSLSSDSEYLCR
VTVRFFEKNFTKEVNITTDYDAPKAPENLTVHPTARNVTVTWMKPTGTLEEHIDGYIVKC
NNTSQNVNRNETSFTCGDLEPYSTGSVSVRAFKKSKYKNKNFEGEKVNGSFQTKPAKPEK
VTDFKLTLLADNTVKVACRSQKVYGNETKFKLSWNSSSNSGENQRKNECNFTVRDLSYLT
KYTFKISVFNGVYTGDSVCEEIYTRYNSRALIIFLVFLIVVTSIALLLVLYKIYDLHQKK
LSNSSEVISLVAVKDDERQLLNIEPIPSEKLLETYKRKIADEGRLFLDEFQSIPRIFTKF
PMKEAKRSHNQNKNRYIDILPYDHNRVELSEIPGDPGSDYINASYIDGFKEPRKYIAAQG
PKDETTDDFWRMIWEQKATIIVMVTRCEEGNRNKCAQYWPSMENGSATYGDITVKINESK
ICPDYIIQKLHITNGRERTSGRDVTHIQFTSWPDHGVPEDPHLLLKLRRRVNALSNFFSG
PIVVHCSAGVGRTGTYIGIDAMLEGLDAEGRVDVYGYVVKLRRQRCLMVQVESQYILIHQ
ALVEYNQYGETEVSLSELHSYLNNLKRKDPPSEPSLLEAEFQRLPSYKGWRTQNTGNREE
NKNKNRSANTIPYDFNRVPIRSEEEQSKEGEHDSEDSSDEDSDCEESSRYINASFITGYW
GPKAMIATQGPLQETISDFWQMVFQRKVKVIVMLTELKEGDQELCAQYWGEGRQTYDDIE
VQVTDVNCCPSYTIRAFDVTHLKRKETQKVYQYQYHKWNGLDVPEDPKDLVDMILSLKQK
VPSRPASEDSRNSRSVPFVIHCCDGSQQTGVFCALMTLLESAETEEVIDVFQVVKALRRS
RLGVVSTFEQYQFLYDTIARTYPAQNGQIKNIHQEDKVEFCNEVEKKDQESDLITIDLTP
STPEENDTPECCDDFKAADTNKGTESSTNGPTTPVLT
NT seq 3714 nt   +upstreamnt  +downstreamnt
atgtttttgtgccttaaactcttggcgtttggcgttgcctttctgtgccaggatgctttt
gcccaagcaggaaatgataatttgacctctgccagctctctctcctctacgttacctaca
cctacacgctccacatcattctcacctccaagcaccactgcaggagttcagccagcatca
actggtgcctctcccacagccagcacgcacctctccacgcactcaggctctggtccgacc
acgggactcggccacttgcagcatagcagccctgctgccctcaccacacgcactctcact
gcctttcatcaaactgtatcagattattacagttcaacatccttgcacaacaccacctca
ccagtcatcacgccagcaagcactgagaccatccccactagcacaatagaaagtactaca
acaacggaagaaccttgtgataatagtattgattacgggaatatagaagaaaagaataac
tcggctgaagttacgctaaagaatctcaaagaaaacagaatatatgatattctgctggaa
gatgggaagagcttatcagtgaatgccagcaacaacatagtaatgcttaattggtgcaga
agatatacagttcaatctcgtagttgcaaggtcatgtatcttactattccacctgatgaa
aaaaggtatacttttggtgccaagagcattggaaacgacaatgcaacattgcgtttaaat
tctttatgtatagattgcgaagatgtctgttctaatgtgactgttagctgcaaaacaaat
tccataaattcaggaggcactgggaatttaactggtagctacgaattgatgaaacatgat
ataaatgctgacaacataacgatactttctttatcatccgacagtgagtacctctgcaga
gttacagtaaggttttttgaaaagaattttaccaaagaagtcaacataactacagattat
gatgctccaaaagcaccagaaaaccttacagtgcatcctactgccagaaatgtaacagtt
acgtggatgaaacctaccggcacattagaagaacatatagatggctatattgtgaagtgc
aataacacttctcaaaacgttaacaggaatgagaccagctttacttgtggtgatttagaa
ccttacagcactggctctgtgtctgtaagagcatttaaaaaaagcaagtataagaataaa
aactttgagggagaaaaagtgaatggcagctttcaaacgaaaccagcaaaaccagagaaa
gtgactgacttcaaactaacattgctggctgataatactgtcaaagttgcctgccgaagt
caaaaagtgtatggaaatgaaacaaaatttaaattatcttggaattccagcagcaacagt
ggtgagaatcagaggaaaaatgaatgcaattttacagtaagagatctctcttacttgaca
aaatatacgtttaagatatctgtgtttaatggagtgtatacaggagactcggtatgtgag
gaaatatataccagatataactcgagggccctgattatattcttggtgttcttgattgtt
gtgacatcaattgctttactgttggttctgtataaaatctatgacctacaccaaaaaaag
cttagcaattcttctgaagtcatcagccttgtagcagttaaagatgatgaaaggcagctt
ttgaacatagagccaataccttcagagaaactgttggagacatacaagaggaagattgct
gatgaaggaagacttttcttggatgaatttcagagcattccaagaattttcactaaattt
ccaatgaaggaggccaagaggagccataatcagaacaaaaaccgttacattgatattctt
ccatatgatcataaccgtgttgagctctctgagattccaggagacccaggatcagactac
atcaacgcaagttatattgatggcttcaaagaaccaagaaaatacattgctgcacaaggc
cccaaggatgaaaccacggatgatttctggagaatgatctgggaacagaaagcaacaatt
attgtcatggttactcgctgtgaggaaggaaacaggaacaaatgtgcccagtactggcca
tcaatggagaatggctctgcaacatatggggacataactgtgaagatcaacgaaagtaaa
atatgtccagactatataattcagaaactgcacatcacaaatggaagagaaagaacatct
ggaagagatgtcactcacattcagttcaccagctggccagaccatggcgttcccgaggat
ccacatctccttctcaaactccgacgcagagtgaatgctctcagcaacttttttagtggc
ccaatagtggttcattgcagtgctggagttgggcgcactgggacctatattggaattgac
gctatgttggaggggctggatgcagagggcagagtggatgtttatggctacgttgtgaag
ctgcgccggcagcggtgcctcatggttcaagtagagtcacagtacatccttatccatcaa
gcactagtggaatacaatcagtatggagaaacagaggtcagcctctcagaactacattcc
tatcttaacaatctgaaaagaaaagatcctccaagtgaaccttctctgctggaggcagaa
tttcagagactgccttcctacaagggatggcggacacagaacactgggaatcgagaggaa
aataagaacaaaaataggagtgccaacacaattccgtatgactttaaccgagtgccgatc
aggagtgaagaggaacaaagtaaggagggtgaacatgattcagaggactcatcagatgag
gacagtgactgtgaagaatcaagcagatacattaatgcttccttcataactggttactgg
ggtccaaaagccatgattgcaacacaaggaccactgcaggaaactatctctgacttctgg
caaatggtattccaaagaaaagtcaaagtcattgttatgctgacagagctgaaagaaggg
gatcaggaactctgtgcacagtactggggagaaggaagacaaacatatgatgacatagaa
gttcaagtgacagatgtcaactgttgtcctagctacaccatacgtgcatttgatgtcaca
catctgaagaggaaagaaacacagaaggtatatcagtatcaatatcacaagtggaatgga
ttggatgttccagaagaccccaaagatttagtcgatatgattctaagccttaaacaaaaa
gtgccatccagaccagcctctgaggacagcaggaacagccgcagcgtcccatttgtcatc
cactgctgtgatggatcgcagcagactggtgtgttttgtgctttgatgaccctcttggaa
agtgcagaaactgaagaagtaatagatgttttccaagtagtaaaagctcttcgtcgcagc
aggctgggagtggtctccacctttgaacaataccaatttctatatgacaccattgctcgt
acctaccctgcccagaatggacaaataaagaacatccatcaggaagataaggttgaattt
tgcaacgaagtagagaaaaaagatcaggaaagtgatttgatcactattgaccttactcca
tcaactccagaggaaaatgatactcctgaatgttgcgatgattttaaggctgcagatacc
aataaggggacagaaagttctacaaatgggcccacaactccagttttaacttag

DBGET integrated database retrieval system