KEGG   Gallus gallus (chicken): 386581
Entry
386581            CDS       T01006                                 

Gene name
ATP4B
Definition
(RefSeq) potassium-transporting ATPase subunit beta
  KO
K01543  H+/K+-exchanging ATPase subunit beta [EC:7.2.2.19]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    386581 (ATP4B)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.19  H+/K+-exchanging ATPase
     386581 (ATP4B)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 386581
NCBI-ProteinID: NP_989749
CGNC: 12620
Ensembl: ENSGALG00000016822
UniProt: Q07420
Position
1
AA seq 299 aa
MATLNEKKTCSERMENFRRFVWNPETKLFMGRTLINWVWISLYYLAFYVVMTGIFALSIY
SLMRTVNPYEPDYQDQLKSPGVTLRPDVYGHRGLQIYYNASDNKTWEGLVTMLQTFLTAY
SPAAQHLNINCTSNTYFIQNTFDGPNNTKLSCKFTSDMLQNCSGITDPTFGFPEGKPCFI
VKMNRIIKFYPGNGTAPRVDCSYVGDESRPLEVEYYPVNGTFNLHYFPYYGKKAQPTYSN
PLVAVKFLNITKNVEVQIVCKIIGAGITFDNVHDPYEGKVEFKLKIEDGAARDTSKKHV
NT seq 900 nt   +upstreamnt  +downstreamnt
atggcaactttaaatgaaaagaagacctgcagtgaacggatggaaaatttccgccgtttt
gtctggaatccagaaactaagctgtttatgggaaggaccttgattaactgggtgtggatc
agcctgtactacctggccttctacgtggtgatgactgggatcttcgccctctccatatac
tccctaatgaggacggtcaatccctacgagccagattaccaagaccagctcaagtcccca
ggtgtaacgttacgaccggatgtgtatgggcacagagggctgcaaatctactacaatgca
tctgacaacaagacctgggaggggctggtgacaatgctccagacgtttctgacagcatat
agcccagctgctcagcatctgaacatcaactgcacaagcaacacatacttcatccagaac
acctttgatggcccaaataacacaaaactgtcctgcaagtttacatcagatatgcttcaa
aactgctctggcatcacagatcctacttttggatttccagaaggaaaaccttgctttatt
gtaaagatgaacaggattatcaaattttatcctggcaacggcaccgcaccgagagtggac
tgcagctatgtaggtgacgagtcccgcccgctggaggtagaatactacccggtgaatgga
accttcaacctgcactacttcccctactatggaaagaaagcacagcccacttacagtaat
cctttggtagctgtgaaatttctcaacatcacaaagaatgtagaagtccagatagtgtgc
aagatcattggagccgggattaccttcgataacgttcatgacccatatgaaggaaaagtg
gaatttaaattgaaaatagaggatggagcagcgagagacacctctaaaaagcatgtgtga

DBGET integrated database retrieval system