KEGG   Gallus gallus (chicken): 39116918Help
Entry
39116918          CDS       T01006                                 

Gene name
CYTB, EZZ34_mgp02
Definition
(RefSeq) cytochrome b
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Motif
Other DBs
NCBI-GeneID: 39116918
NCBI-ProteinID: YP_009558663
Structure
PDB: 

Position
MT
AA seq 380 aa AA seqDB search
MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADT
SLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVIL
LLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWGGFSVDNPTLTRFF
ALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVL
ILFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYF
TILLILFPTIGTLENKMLNY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaacattcgaaaatcccaccccctactaaaaataattaacaactccctaatc
gacctcccagccccatccaacatctctgcttgatgaaatttcggctccctattagcagtc
tgcctcatgacccaaatcctcaccggcctactactagccatgcactacacagcagacaca
tccctagccttctcctccgtagcccacacttgccggaacgtacaatacggctgactcatc
cggaatctccacgcaaacggcgcctcattcttcttcatctgtatcttccttcacatcgga
cgaggcctatactacggctcctacctctacaaggaaacctgaaacacaggagtaatcctc
ctcctcacactcatagccaccgcctttgtgggctatgttctcccatggggccaaatatca
ttctgaggggccaccgttatcacaaacctattctcagcaattccctacattggacacacc
ctagtagagtgagcctgagggggattttcagtcgacaacccaacccttacccgattcttc
gccttacacttcctcctcccctttgcaatcgcaggtattactatcatccacctcaccttc
ctacacgaatcaggctcaaacaaccccctaggcatctcatccgactctgacaaaattcca
tttcacccatactactccttcaaagacattctgggcttaactctcatactcaccccattc
ctaacactagccctattctcccccaacctcctaggagacccagaaaacttcaccccagca
aacccactagtaacccccccacatatcaaaccagaatgatattttctattcgcctatgcc
atcctacgctccatccccaacaaacttggaggtgtactagccctagcagcctcagtcctc
atcctcttcctaatccccttcctccacaaatctaaacaacgaacaataaccttccgacca
ctctcccaaaccctattctgacttctagtagccaaccttcttatcctaacctgaatcgga
agccaaccagtagaacaccccttcatcatcattggccaaatagcatccctctcttacttc
accatcctacttatcctcttccccacaatcggaacactagaaaacaaaatactcaactac
taa

DBGET integrated database retrieval system