KEGG   Gallus gallus (chicken): 395069Help
Entry
395069            CDS       T01006                                 

Gene name
COL2A1
Definition
(RefSeq) collagen alpha-1(II) chain precursor
  KO
K19719  collagen, type II, alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    395069 (COL2A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395069 (COL2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395069 (COL2A1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   395069 (COL2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI
Motif
Other DBs
NCBI-GeneID: 395069
NCBI-ProteinID: NP_989757
CGNC: 49161
Ensembl: ENSGALG00000030712
UniProt: Q90W37
Position
33
AA seq 1420 aa AA seqDB search
MHGRRPPRSAALLLLLLLLTAAAAAQDRDLRQPGPKGQKGEPGDIKDVVGPRGPPGPQGP
AGEQGQRGDRGEKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGF
DEKAGGAQMGVMQGPMGPMGPRGPPGPTGAPGPQGFQGNPGEPGEPGAAGPMGPRGPPGP
PGKPGDDGETGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGA
KGESGSPGENGSPGPMGPRGLPGERGRPGPSGAAGARGNDGLPGPAGPPGPVGPAGAPGF
PGAPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGAPGNPGTDGIPGAKGSAGAPGI
AGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGETGPAGPQGAPGPAGE
EGKRGARGEPGAAGPVGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPAGLAGPKGATGD
PGRPGEPGLPGARGLTGRPGDAGPQGKVGPTGAPGEDGRPGPPGPQGARGQPGVMGFPGP
KGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPVGERGEQGAPGPSGFQGL
PGPPGPPGESGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGT
DGPKGATGPAGPNGAQGPPGLQGMPGERGAAGIAGLKGDRGDVGEKGPEGAPGKDGARGL
TGPIGPPGPAGPNGEKGESGPPGPSGAAGARGAPGERGEPGAPGPAGFAGPPGADGQPGA
KGEQGEPGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGP
PGPNGNPGPPGPPGSAGKDGPKGVRGDAGPPGRAGDPGLQGPAGPPGEKGEPGEDGPAGP
DGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGSAGDRGPPGPVGPPGL
TGPAGEPGREGNPGADGLPGRDGAAGVKGDRGETGPVGAPGAPGAPGAPGPVGPTGKQGD
RGETGAQGPMGPSGPAGARGMPGPQGPRGDKGETGEAGERGLKGHRGFTGLQGLPGPPGP
SGDQGAAGPAGPSGPRGPPGPVGPSGKDGSNGMPGPIGPPGPRGRSGEPGPAGPPGNPGP
PGPPGPPGTGIDMSAFAGLGQTEKGPDPIRYMRADEAAGGLRQHDVEVDATLKSLNNQIE
SIRSPEGSKKNPARTCRDIKLCHPEWKSGDYWIDPNQGCTLDAIKVFCNMETGETCVYPT
PSSIPRKNWWTSKTKDKKHVWFAETINGGFHFSYGDENLSPNTASIQMTFLRLLSTEGSQ
NVTYHCKNSIAYMDEETGNLKKAILIQGSNDVEIRAEGNSRFTYSVLEDGCTKHTGKWGK
TVIEYRLQKTSRLSIVDTAPMDIGGADQEFGVDIGPVCFL
NT seq 4263 nt NT seq  +upstreamnt  +downstreamnt
atgcacggccgccgcccgccccgctccgccgctctcctcctcctcctcctccttctcacg
gccgccgcagccgcgcaggaccgcgacctccgacaacctggccccaagggacagaaggga
gaacccggagatattaaagatgttgtaggaccccgagggcctccaggaccacagggccca
gcaggagagcagggacagcgaggggaccgtggcgagaagggggagaagggtgctcctggc
ccccgtgggagggatggagaacccggcacccctggaaacccaggcccccccggtcccccc
ggacctcctggcccccccggacttggtggaaactttgcggcgcagatggcgggcggcttc
gatgagaaggcgggtggagcgcagatgggtgtcatgcagggacccatgggccctatggga
ccccgcggcccccctggccccactggcgcacctggtccccagggatttcaaggcaacccc
ggtgagcccggcgaacccggcgctgctggtccgatgggtccccggggacctccgggacca
cctgggaaacccggtgacgatggtgagacaggcaaacccggcaaatctggtgaacgtggc
ccccccggcccccagggcgctcgtggcttccctgggactcctggtctccccggagtgaag
ggccaccgaggctaccccggtttggatggtgccaaaggagaggcgggggctcctggagcc
aagggtgaatctggttcaccgggtgagaacggctcccccggccccatgggaccccgtggg
ctgcccggagagcgaggacgtcccggcccctccggcgccgccggtgctcgtggcaatgac
ggtctccctggccctgctggaccccctggacccgtcggccctgccggagcccccggcttc
cccggagcccccggttcaaagggtgaagccggccccactggtgcacggggtcccgagggt
gcccaaggaccccgcggcgaatccggcacccccggctctcccggccccgctggcgcaccc
ggtaacccagggactgatggcatccccggtgccaagggctcggcgggtgccccgggcatt
gcaggcgctccaggattccccggcccacgcggcccccccggaccccaaggtgccaccgga
ccactgggacccaaaggacagacgggcgaacccggcatcgcaggcttcaagggcgagcaa
ggaccgaagggcgagacgggccccgcaggaccccaaggtgcccccgggccggctggtgag
gaaggcaagagaggagctcgtggtgaacctggtgccgccggccctgtgggcccccccgga
gaaaggggcgctcctggcaaccgtggattccccgggcaggacgggctggccggacccaag
ggtgctccaggtgaacgcggccccgctggtctcgccggtcccaaaggtgccaccggtgac
cccggacgtcccggagagcccgggctgcccggagcgaggggtctcaccggccgccccggc
gatgcgggacctcaaggcaaagtcggcccaactggtgctcctggcgaggatggccgcccc
ggcccccccggacctcagggtgctcgtgggcagcctggtgtgatgggtttccccggtccc
aaaggcgctaatggtgagcctggaaaagctggagagaaaggactgcccggcgccccaggg
ctgcggggtctgcctggcaaggatggggagacgggagctgccggcccccctggacccgct
ggtcctgtgggtgagagaggagagcaaggagcccccggtccttccggcttccagggactg
cccggaccaccaggtccccctggggagagcggcaaacccggagaccagggtgttcctgga
gaagccggtgcccccggtcttgttggtcccagaggtgaacgtggattccccggtgaacgc
ggctctcccggtgcccaagggctgcagggtccccgtgggctccccggaacgcccggcact
gacggacccaagggtgcaaccggtccagccggccccaacggtgcccagggtcccccaggg
ctgcagggaatgcccggtgagagaggagcagctggcatcgctggcctcaagggtgaccgg
ggagatgttggtgagaaaggacctgagggagctccaggcaaggatggcgcacgtggtctg
acgggtcccattggtccccctggccctgctggccccaacggtgagaagggtgaatccggc
cctcctggtccatctggtgctgccggtgcccgtggtgcccccggtgagcgtggcgagccc
ggtgcccccggtcctgctggatttgctggccccccgggcgccgatggacaacccggtgcc
aaaggcgagcagggagagcccgggcagaagggtgacgcgggcgctcctggtccccaaggt
ccctccggcgctcctggcccccagggcccaaccggtgtcactggtcccaaaggagctcgt
ggggctcagggtccccctggagccacgggattccccggagctgccggccgtgtgggaccg
cccggccctaatggtaacccaggcccccccggaccccctggctctgctggcaaggacggc
cccaagggtgttcgtggcgacgccggcccccccggccgtgcaggtgaccccggcctccaa
ggccccgccggcccccccggcgagaagggcgaacccggcgaggacggccccgcgggtccc
gacggcccccccggccctcaaggcttggcaggacagcgtggtattgtgggtctcccagga
cagcgtggtgagagaggcttccccggactgccggggccatcgggagaacctggaaagcaa
ggagcgcctggctctgcgggtgaccgaggtccccccggccccgtggggccccctgggctg
acgggtcctgctggagaacccgggcgcgagggcaaccctggtgctgacggtctcccaggc
agggatggcgcagctggcgtgaagggtgatcgtggtgagaccggccctgtgggtgccccc
ggtgctcctggagcccctggcgcccccggccctgttggtcccactggaaaacaaggagac
agaggcgagacgggtgcacaagggcccatgggtccctctggtcccgctggagctcgagga
atgccgggtccccaaggacctcgtggtgacaaaggtgagacgggagaggctggagagaga
gggctgaagggccaccgtggcttcaccggtctgcagggtctgcccggaccacccggcccg
tctggagaccaaggtgctgccggtcccgctggtccctccggtcccagaggtccccctggt
cccgtcggcccctctggcaaagatggctctaacggcatgcccggccccatcggtcctccc
ggtccccgtggacggagtggtgaacccggccctgcgggtcctcctggaaaccccggtcct
cccggtcctcctggcccccccggcaccggcatcgacatgtctgcttttgctggactgggt
cagacggagaagggccccgaccccatccgctacatgagggcagacgaggcggccggaggg
ctgcggcagcacgacgtggaggtggatgccaccctcaaatccctcaacaatcagattgag
agcatccgcagccccgagggctccaagaagaaccctgccaggacctgccgcgacatcaaa
ctctgccatcccgagtggaagagcggagattactggattgacccgaaccagggctgcacc
ttggacgccatcaaagtattctgcaacatggagacgggcgagacctgcgtctacccgacc
cccagcagcatccccaggaagaactggtggaccagcaagacgaaagacaagaagcacgtc
tggtttgcagagaccatcaacggcggtttccacttcagctacggcgatgagaacctgtcc
cccaacaccgccagcatccagatgaccttcctgcgcctcctgtccaccgagggctcccag
aacgtcacctaccactgcaagaacagcatcgcctacatggacgaggagacgggcaacctg
aagaaagccatcctcatccagggatccaacgacgtggagatcagagccgagggcaacagc
aggttcacctacagcgtcttggaggacggctgcacgaaacacactggcaaatggggcaag
acggtgatcgagtaccggttgcagaagacctcgcgcctgtccattgtagatactgcacct
atggacattggcggagccgatcaggagtttggcgtggatattggcccagtctgcttcttg
taa

DBGET integrated database retrieval system