KEGG   Gallus gallus (chicken): 395076
Entry
395076            CDS       T01006                                 

Gene name
CDKN2B
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04110  Cell cycle
gga04218  Cellular senescence
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395076 (CDKN2B)
   04068 FoxO signaling pathway
    395076 (CDKN2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    395076 (CDKN2B)
   04218 Cellular senescence
    395076 (CDKN2B)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 395076
NCBI-ProteinID: NP_989764
CGNC: 20082
Ensembl: ENSGALG00000026137
UniProt: Q7ZT27
Position
Z
AA seq 139 aa
MAQRAASTAADELANAAARGDLLRVKELLDGAADPNAVNSFGRTPIQVMMLGSPRVAELL
LQRGADPNRPDPRTGCRPAHDAARAGFLDTLAALHRAGARLDLPDGRGRLPIDVAAGGPH
GPVGCYLRRLPALPRAPLP
NT seq 420 nt   +upstreamnt  +downstreamnt
atggcgcagagagcggccagcacggctgcggatgaactagccaacgccgccgcccgcggc
gatctgctgcgggtgaaggagctactggacggcgcggccgaccccaacgctgtcaactcc
ttcggtcggacccccatccaggtgatgatgctgggcagccctcgcgtggccgagctgctg
ctgcagcgcggcgccgaccccaaccgccccgacccgcgcaccggctgccgccccgcacac
gacgcggcccgcgccggcttcctggacacgctggcggcgctgcaccgcgccggggcgcgc
ctcgacctgcccgacggccgcggccgcctccccatcgacgtggcggccgggggcccgcac
ggcccggtcggctgctacctgcgacggctgccagcgctaccgcgagcacccctcccctga

DBGET integrated database retrieval system