KEGG   Gallus gallus (chicken): 395098
Entry
395098            CDS       T01006                                 

Gene name
BRINP1
Definition
(RefSeq) BMP/retinoic acid-inducible neural-specific protein 1 precursor
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: BRINP MACPF
Other DBs
NCBI-GeneID: 395098
NCBI-ProteinID: NP_989780
CGNC: 5279
Ensembl: ENSGALG00000006997
UniProt: Q7ZZR3
Position
17
AA seq 761 aa
MNWRLVEFLYLLFIWDHILVQPSHQDPAATNQHVSKEFDWLISDRGPFHHSRSYLSFVER
HRQGFTTRYKIYREFARWKVRNTAIERRDLLHNPLPLMPEFQRSIRLLGRRPTTQQFIDT
IIKKYGTHILISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMR
RLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQE
KFVQSALSYIMCNGEGEYICRNSQCGCQCAEEFPQCNCPITDIQIMEYTLANMAKTWTEA
YKDLENSDEFKSFMKRLPSNHFLTIASIHQHWGNDWDLQNRYKLLQSSLEAQRQKIQRTA
RKLFGLSVRCRHNPNHQLPRERTIQEWLTRVQSLLYCNENGFWGTFLESQRSCVCHGGTS
LCQRPIPCIIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETD
LDFQDLELKYLLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHM
VIGISMRICQMRNSSLDPMFFVYVNPFSGSHSEGWNMPFGEYGYPRWEKIRLQNSQCYNW
TLLLGNRWKTFFETVHIYLRSRTRLPSLLRNETGQGPVDLSDPSKRQFYIKISDVQVYGY
SLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLF
SCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgaactggaggcttgttgagttcctctacctcctgtttatatgggaccatatactagta
cagccctcccaccaggacccagctgccaccaaccaacatgtctccaaggagtttgattgg
cttatttcagacagggggcctttccaccactcgcggagctacttatcctttgtggaaaga
catcgtcaaggatttacaaccagatataaaatatacagggagtttgcccgttggaaggtg
aggaacacagccattgagcggagggacctgctccacaacccactgcccctgatgcctgag
ttccagaggagcatccgcctcctgggccggagacccaccacgcagcagttcatcgatacc
atcatcaaaaagtacggcacccacatcctcatctctgccaccctgggaggagaggaggcc
ttgaccatgtacatggacaaaagtcgcctcgacaggaagtcaggaaatgctacccagagc
gtggaagctttgcaccagctcgcttcctcctacttcgtagaccgtgatggcaccatgagg
agactccatgagatccagatctctaccggagcaatcaaggtaacagaaactcggactggc
cccctgggctgtaacagctacgacaatctggactctgtgagttctgtccttctgcaaagc
actgaaagcaaactccacctgcaaggtctccagatcatcttcccccagtacctacaagag
aagtttgtccagtctgccttgagctacatcatgtgcaatggggagggcgagtacatctgc
cggaacagccaatgcggctgccaatgcgcggaggagttcccacagtgcaactgccccatc
actgacatccagatcatggagtacactctagccaacatggccaagacctggacagaagcc
tataaagatctggagaattcagatgagttcaaatccttcatgaaaaggctacctagcaac
cacttcctgaccattgcgagcatccaccagcactgggggaatgactgggacctgcagaac
cgctacaagctgctgcagagctccttggaagcccagcgccagaagatccaacgcactgcc
cgcaaactcttcggcctcagtgtccggtgtcggcacaaccccaaccaccagctgcctaga
gaaaggacgatacaggaatggcttacccgggtccagtccctactctactgcaacgagaat
gggttttggggcacttttttggaaagccagaggagctgtgtttgtcacggtggcaccagc
ttgtgccaacgtcccatcccttgcatcattgggggcaacaacagctgtgccatgtgcagc
cttgccaacatctctctctgtggctcgtgcaacaagggctataagctttatcggggccgt
tgcgagcctcagaacgtagactcagagcggagtgaacaattcatcagcttcgagacggac
ttggacttccaggacctagagttgaagtacctgctgcagaaaatggactctcgcttgtat
gtgcataccaccttcatcagcaacgagatccgcctggacaccttctttgatcccaggtgg
cgcaaacgcatgtccctcaccttgaagagcaacaagaacaggatggacttcatccacatg
gtgattgggatctccatgcgtatctgccagatgcgcaacagcagcctagaccctatgttc
tttgtctatgtcaacccgttcagcgggagtcactccgaaggctggaatatgccctttggg
gagtatggctacccacgctgggagaaaatccgcctccaaaacagccagtgctacaactgg
accctgctactgggcaaccggtggaaaacctttttcgagaccgtccacatctacctacgc
agccggacgcggctgccctccctgctgcgaaacgagacgggccaagggcccgtggacctt
tctgaccccagcaagcgccagttctacatcaagatctcggacgtgcaggtgtacggctac
agcctgcgcttcaacgctgaccttctgcgcagcgccgtgcagcaggtcaaccagtcgtac
acgcaaggggggcagttctattcttcctcctctgtcatgctcttgctgctggatattcgg
gaccgaatcaatagactggcacctcctgtggccccggggaagccccagctggatctgttc
tcttgtatgctcaagcaccgcctgaagctcaccaacagtgagatcatccgtgtgaaccat
gctctagacctgtacaacaccgagatcctcaaacagtcggaccagatgacagccaaactc
tgctaa

DBGET integrated database retrieval system