KEGG   Gallus gallus (chicken): 395104
Entry
395104            CDS       T01006                                 

Gene name
TBX18
Definition
(RefSeq) T-box transcription factor TBX18
  KO
K10183  T-box protein 18
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395104 (TBX18)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other transcription factors
   T-box
    395104 (TBX18)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 395104
NCBI-ProteinID: NP_989784
CGNC: 49172
Ensembl: ENSGALG00000032789
UniProt: Q7T2Z6 Q68SB0
Position
3
AA seq 589 aa
MADKRRASPGATMSLKAHAFSVEALIGAEKQQPPAPPPRQPKRRKVGGEDEAADDEGGSG
CCAGSPAATSGRNGGDMEPGCARGPAGAEEGFAAASPPASPGGGSPKGSGPASPLPAPQA
PRVELQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKR
YRYVYHSSKWMVAGNADSPVPPRVYIHPDSPACGETWMRQVISFDKLKLTNNELDDQGHI
ILHSMHKYQPRVHVIRKDCGDDLSPVKPIPSGEGVKAFSFPETVFTTVTAYQNQQITRLK
IDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQGNAGSSTLLQGS
GSGVPSTHPHLLPGSPCSSPAFHLSPNTSQLCSLAPADYTACARSGLTLNRYSTSLAETY
NRLTNQTSETFAPPRTPSYVGVSSSTTVNMSMSGNDGDAFSCPQTGLSMQISGMSPQLQY
IMPSPSSNAFTTNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSS
PSGTMTDRQMLPPVEGVHLLSSGGQQNFFDSRTLGSLTLSSSQVSAHMV
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccgacaagcggcgggcctcgcccggcgccaccatgagcctgaaggctcacgccttc
tcggtggaggcgctcatcggggccgagaagcagcagccgcccgcgccgcccccgcggcag
cccaagcggcggaaggtgggcggcgaggacgaggcggcggacgacgaagggggcagcggc
tgctgcgccgggagcccggcggccaccagcggcaggaacggcggcgacatggagccgggc
tgcgcccgcgggcccgccggcgccgaggagggtttcgcggcggcgtccccacccgcctcg
cccggcggcggctccccgaagggctccgggcccgcctcgcctctgcccgcgccccaggca
ccgcgcgtggagctgcagggcgccgagctctggaagcgcttccacgagatcggcaccgag
atgatcatcaccaaggcgggcaggcggatgtttcccgcgatgagagtgaagatctcaggt
ttagacccccatcagcagtattacatcgctatggatatcgtgccagtggataacaaaaga
tacaggtacgtttatcatagctccaagtggatggtggccggtaatgctgactccccggta
ccgcctcgtgtttatattcaccctgattcacccgcctgcggggagacgtggatgagacaa
gtgatcagcttcgacaaactgaagctcaccaataatgaacttgacgatcaagggcatatt
atccttcactctatgcataaataccagcctcgtgtccacgtcatccgaaaagactgtgga
gatgatctgtccccggtaaagcctattccttcgggagaaggagtcaaagcattctccttt
ccagagacagttttcaccactgtcacagcataccaaaatcaacagataactcgtctgaag
attgacaggaatccatttgccaaagggtttagagattcaggacgtaacagaatgggactg
gaagctttggtggagtcttacgccttctggagaccttcacttaggacacttacatttgaa
gatatacctgggatacctaaacaaggaaatgcaggttcttctaccttactccagggatct
ggcagtggagtgccttctacccaccctcaccttttgccgggttccccttgctcatctcca
gccttccatctcagtcccaacactagccagctctgtagccttgctcctgctgactacaca
gcttgtgcccgctcaggtttgaccctgaacagatacagcacttctttggctgaaacctac
aacaggctcacaaaccaaaccagtgagacatttgcacccccaaggactccctcttatgtt
ggtgtgtcgagtagcacaactgtgaatatgtcaatgagcggcaatgacggggatgcattc
agctgcccgcaaactggcttatctatgcagatttcagggatgtctccacagctccagtac
atcatgccatccccttccagcaatgcctttaccactaatcaaacccaccaaggctcctac
aacacatttagactgcatagtccctgtgcgctgtacggatataacttttcgacatctcct
aaactggctgccagtcctgagaaaattgtttcttcccaaggaagtttcttggggtcctcg
ccgagtggaaccatgacggatcggcagatgttgccccctgtggaaggagtgcacttactt
agcagtggggggcagcagaatttctttgactctaggaccctaggaagcttgacactctca
tcttctcaagtgtctgcacatatggtttga

DBGET integrated database retrieval system