KEGG   Gallus gallus (chicken): 395128Help
Entry
395128            CDS       T01006                                 

Gene name
HES4
Definition
(RefSeq) transcription factor HES-4 isoform 1
  KO
K06054  hairy and enhancer of split 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga03460  Fanconi anemia pathway
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    395128 (HES4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    395128 (HES4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395128 (HES4)
   03400 DNA repair and recombination proteins [BR:gga03400]
    395128 (HES4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    395128 (HES4)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     395128 (HES4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hairy_orange HLH
Motif
Other DBs
NCBI-GeneID: 395128
NCBI-ProteinID: NP_001005848
CGNC: 49182
Ensembl: ENSGALG00000002055
UniProt: Q6XLQ0
Position
21
AA seq 290 aa AA seqDB search
MPADTGMEKPTASPIAGAPASASHTPDKPRSASEHRKSSKPIMEKRRRARINESLGQLKM
LILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMAAALSADPSVLGKYRAGFNECMN
EVTRFLSTCEGVNADVRARLLGHLSACLGQIVAMNYLPPPPAGQPAHLAQPLHVQLPPTT
TGAVPVPCKLEPTEALSPKVYGGFQLVPATDGQFAFLIPNPAFPPGSGPVIPLYANANVP
VSTSGGSGNASTTPSASPVQGLTSFGHSVVPASQAGSPIAERRESVWRPW
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgacacgggcatggaaaaacccaccgcttcccccatcgcgggggcaccggcc
agcgccagccacacgccggacaaacctcggagcgccagcgagcaccggaagtcctccaaa
cccatcatggagaagcgacggcgggcgcgcatcaacgagagcctggggcagctgaagatg
ctcatcctggacgcgttgaaaaaagacagctctcggcactccaagctggagaaggcggac
atcctggagatgacggtgaagcacctgaggaacctccagagggcacagatggcagccgct
ctcagcgctgaccccagcgtgctgggcaaataccgggctggtttcaatgagtgcatgaac
gaggtgacgaggttcctgtccacctgcgagggggtgaacgccgacgtgcgagcccgcctg
ctgggccacctctctgcttgcctggggcagatcgtggccatgaactacctgccaccccct
cctgctggccaacccgcacatctggctcaacccctgcacgtccaactgcctcctaccacc
accggagcggtgccggtgccgtgcaagctggaaccgaccgaagctctctcccctaaagtc
tatgggggtttccagctcgtcccggccactgacggtcaattcgccttcctcatccccaac
cctgcgttcccacctggctctggaccggttatcccactctacgccaacgccaacgtccca
gtgtccacaagtggaggctctgggaacgcgtccaccaccccatcagcatccccggtgcag
ggcttgacatcatttgggcacagcgtggtgccggcatcccaggcaggcagccctattgct
gagcgcagggagtccgtctggaggccgtggtga

DBGET integrated database retrieval system