KEGG   Gallus gallus (chicken): 395138Help
Entry
395138            CDS       T01006                                 

Gene name
ST3GAL6
Definition
(RefSeq) type 2 lactosamine alpha-2,3-sialyltransferase
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00601  Glycosphingolipid biosynthesis - lacto and neolacto series
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    395138 (ST3GAL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    395138 (ST3GAL6)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     395138 (ST3GAL6)
Glycosyltransferases [BR:gga01003]
 Terminal extension
  Sialyltransferase
   395138 (ST3GAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 395138
NCBI-ProteinID: NP_989810
CGNC: 11351
Ensembl: ENSGALG00000015252
UniProt: Q70D52
Position
1
AA seq 352 aa AA seqDB search
MKRILLFFILAAAVMYGILHGNLWRNNFYWISFYGQTSSVRGPSSSEASGVTQLPPTAVE
RRNALNTCTLKPAFESLLDVEKIYPFLCASDFIRVAEYHGSDKFELPYGIKRAEQFFRSA
LSKLQNCGLSNKDDSVACRRCVVVGNGGVLRNKTLGGKIDSYDVIIRMNNGPVIGYEEDV
GRRTTFRLSYPESIFSDPIHYDPNTTVVIIVFKPRDLKWLWEILGGQKISAKGFWKKPAL
NMIYKSNQIRILDPSITRKTAYDWLHFPTRFPKKEKPKHPTTGLIAITLAFHICHEVHLA
GFKYDFTDRNSSLHYYGNETMSQMMQNEYHDISAEQKFLKKLIDKNFVVNLT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcttctgtttttcatcctggctgctgctgttatgtacggtatattgcat
ggaaatctgtggagaaataacttctactggattagcttttatggacagacttcttctgtg
aggggtccttcttccagtgaggctagtggagttacccagctgccacctacggctgtggag
agaaggaacgccctaaacacttgcactctgaaaccagcatttgaatctttactggatgtt
gagaaaatatacccgttcctgtgtgccagtgattttatcagagtggcagagtaccatgga
agtgataagttcgagctaccttatggaataaagagagcagaacaattttttcgttcagcc
ctttcaaaactgcaaaattgtggactgtccaacaaagacgacagtgttgcctgccgacgg
tgtgttgtggtcggtaatggaggagtacttcgaaataagacgttaggagggaaaattgac
tcctatgatgtgataataagaatgaataatggccctgttatagggtacgaagaggatgtt
gggagaaggacgactttccgcctttcctacccagaatccatcttctcagatccaatccac
tacgaccctaacactactgttgttattatcgtcttcaaaccacgtgacttaaagtggctt
tgggagattttaggtggtcagaaaataagtgctaaaggcttttggaagaaaccagctcta
aacatgatatataaatctaatcaaatcaggattcttgatcccagcatcaccagaaaaaca
gcttatgattggcttcatttcccaacaagatttcccaaaaaagagaaacccaagcatcca
acaacggggctaattgccattacactagcatttcacatttgtcatgaagttcacctggcg
ggcttcaaatatgacttcactgacaggaacagttctttgcactactatggcaacgaaaca
atgtctcagatgatgcagaatgaataccatgacatcagtgctgagcagaaattcttgaag
aagcttatagacaagaactttgtggtcaacttgacgtga

DBGET integrated database retrieval system