KEGG   Gallus gallus (chicken): 395152
Entry
395152            CDS       T01006                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395152 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    395152 (AXIN2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    395152 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind DUF4827
Other DBs
NCBI-GeneID: 395152
NCBI-ProteinID: NP_989822
CGNC: 49191
Ensembl: ENSGALG00000039200
UniProt: Q6TLV9
Position
18
AA seq 837 aa
MSSAVLLAHLPDPGSSFREDAPRPPVPGEEGDAPPCPQPHSSFLAKSQSFPAMPVPAAPR
RNENGLGEPEGSASPDSPLARWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNG
FRQMDLKDTKTSRVAKAIYKRYIENNSIVSKQLKPATKTYIRDSIKKQQIDSIMFDQAQT
EIQTVMEENAYQMFLTSDIYLEYVRSGGENPAYMSSNGLGSLKVVCGYLPTLNEEEEWSC
ADFKSKMLPSVVGLSSKTLRVTAGVRATETLENGYRSFKRNDPVNPYHVSSGYVFAPATS
ANDSEISSDALTDDSMSMTDSSVDGIPPYRIGSKKQLQREMHRSVKANGQVSLPHFPRTH
RLPKEMTPVEPAAFAAELISRLEKLKQEQETMDSLEERLQQIKEDEEKEGLELPASLQSS
REMVNPQHQQHPLSLLPSGSYEEDPQAILDEHLSRVLKTPGCQSPGMGRHSPRARSPDHL
LGGKLQPSTASPATCALLGKGFITKQTTKHVHHHYIHHHAVPKTKEQIEAEAAQRVQCCC
PAGSDYYCFSKCKGHPKGTDPPLPPLEPFGRTGTLTKRPGRGVESIALLPGDGGLPGPSG
VQLPGGEADRAQNVWQWMLESERQNKHKPHSTQSTKKAYSSDFAKGAPSERPGRHHPWGP
GSHPRGAQPAHPFIQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCSTSNQQRDRNH
STAVQGGNTPFCNASLTTEDHKEPKKLPVVHTSQSSELVVTYFFCGEEIPYRRMLKAQSL
TLGHFKEQLSKKGNYRYYFKKASDEFDCGAVFEEIWEDETILPMYEGRILGKVERID
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagcagcgccgtgctcctcgcccacctcccggaccccggcagcagcttcagggaggac
gcgccccgacccccggtgccgggggaggagggagacgcaccgccatgcccgcagccccac
agctcctttctcgccaaaagccaaagcttcccggccatgccggtgcccgctgccccgcgg
aggaatgagaacgggctgggggagccggagggcagcgcgtcccccgattccccgctggcc
cgctggaccaaatccctgcactccttgttgggagatcaagatggtgcctatctctttcgg
accttcttggaaagggaaaaatgcgtggataccttagacttctggtttgcctgcaatggc
ttcaggcagatggaccttaaggataccaaaacttcacgagtagccaaagctatctacaaa
aggtacatcgagaacaacagcatcgtctccaagcagctcaagcctgctaccaagacctac
ataagggatagcatcaagaagcagcagatagattccatcatgtttgatcaggcacagact
gagatccagactgtgatggaggaaaatgcgtaccagatgtttttaacttctgatatatac
ctcgaatacgtgcggagcggaggagagaaccccgcttacatgagcagcaacgggctgggg
agcttaaaagttgtctgtggctacctgccgaccttgaacgaggaggaggaatggagctgc
gccgacttcaaaagcaaaatgctgccttcggtggttgggctgtccagcaaaacgctgagg
gttacggcgggcgtcagagccaccgagacgttggagaacgggtacaggtccttcaagagg
aacgatcccgttaacccctaccatgtgagttctggctatgtctttgccccagcaaccagc
gcaaacgatagtgagatatccagtgatgccctgacggatgactccatgtcaatgacagac
agcagtgtagatgggatccccccgtacagaattgggagcaagaagcagctccagagagaa
atgcatcgcagtgttaaggccaacggtcaagtttctctacctcattttccgaggacccac
cgccttcccaaggagatgaccccggtggagccggctgcctttgctgcggagctcatttcc
cggctggagaagctgaagcaggagcaagaaaccatggacagtctggaggagaggctgcag
caaatcaaggaggatgaggagaaggaaggcttggagctccccgccagcctgcagagcagt
cgggagatggtgaacccccagcaccagcagcaccccctctcactcctgccatctggcagc
tacgaggaggacccccaggccatcctggatgagcacctctcccgcgtgctgaagaccccc
ggctgccagtcgcctggcatgggccggcacagcccccgcgcccgctcccctgaccacctg
ctggggggtaagctgcagcccagcactgcctcaccagccacctgcgccctcctgggtaag
ggatttatcaccaagcagaccaccaagcacgtccaccaccactacatccaccatcacgcc
gtgcccaagacgaaggagcagatcgaagcggaggcagcgcagcgggtacagtgctgctgc
ccggcaggcagtgactactactgcttctccaagtgcaaaggccacccgaagggcactgac
ccacctctccctccactggagccctttggcaggacaggcacgctgaccaagaggccgggc
cgaggagtggagagcatcgccctgctgcccggggacggagggctgcccggccccagcggg
gtgcagctacctggcggtgaggcggaccgggcacagaacgtctggcagtggatgctggag
agcgagagacaaaataagcacaagccccatagcacacaaagcacaaagaaggcctacagc
tccgacttcgccaagggggcccccagcgagcgccccggccgccaccacccctgggggccc
ggcagccacccgcgcggggcgcagcccgcccaccccttcatccaggaccccgccatgccc
cctctcaccccacccaacaccctcgcccagttggaggaagcgtgccgccggctcgccgaa
gtctccaagcctcagaagcaacgatgttcaacctcaaatcagcagagggatcgaaaccac
tccactgctgtacaggggggaaacacccctttttgcaatgcaagtctaacgacagaagat
cacaaagagccaaagaaactcccggttgttcacacctctcagtctagtgagttggttgtc
acctattttttttgcggagaagaaattccctacaggaggatgttaaaggcccagagcctg
acacttgggcactttaaggagcagctgagcaaaaagggaaattatagatactacttcaaa
aaggcaagcgacgagtttgactgcggtgcagtgtttgaagagatctgggaagacgaaaca
attctgcccatgtacgaaggaaggattcttgggaaagtagaaaggatcgattga

DBGET integrated database retrieval system