KEGG   Gallus gallus (chicken): 395168
Entry
395168            CDS       T01006                                 

Gene name
FAT1
Definition
(RefSeq) protocadherin Fat 1 isoform X4
  KO
K16506  protocadherin Fat 1/2/3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395168 (FAT1)
   04515 Cell adhesion molecules [BR:gga04515]
    395168 (FAT1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395168 (FAT1)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Cadherin related
   395168 (FAT1)
SSDB
Motif
Pfam: Cadherin Laminin_G_2 Cadherin_3 EGF Laminin_G_1 EGF_CA hEGF Laminin_G_3
Other DBs
NCBI-GeneID: 395168
NCBI-ProteinID: XP_004936047
CGNC: 10185
Ensembl: ENSGALG00000013579
Position
4
AA seq 4622 aa
MGRYLTMLLLLMLLVQHIGNCEGNQIPHHASPMQFTQAQYNATVYENSAAKTYVGHPVKM
GIYIVNPLWDLRYKIISGDNENLFKAEEYVLGNFCFLRIRTKGGNTAILNREVKDHYMLT
VKAVEKNTNAETRTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIG
TNGEFYYSFKERTDVFAIHPTSGVVVLTGRLDYLDTKLYEMEILAVDRGLKLYGSSGISS
MAKLTVYVEQANEYAPVITAVTLTPSESDKDPTYAIVTVEDNDQGSNGEIASLNIVAGDP
LQQFRTVRSVPGGKEYRIKAVGHIDWESQPSGYNLTLQAKDKGNPPQFSSVKVVHVTSSR
FKSGPVRFEKEIYRAEISEFAPPNTPVIMVKALPSYPHLKYVFKNTPGKVKFNLNTHTGL
ITTSEPIKAQYSSHFELEVVTSDRRASAKVLIKVLGMNSNPPEFTQTAYKASFDENVPIG
TSVMRVSAKDPDEGENGYVTYSIANLNPLPFVINHFSGIISTSEDLDYELMPRVYNLRIR
ASDWGVPYRREVEVPVTIILNNLNDNIPLFEKINCEGTIPRDLGVGEQITTVSAIDADEL
QLVRYQIESGNELDLFSLNPNSGVLSLKQSLTDGPGAKMSFHSLKITATDGENFAKPLYI
NITVATGRKLVNLQCEETGVAKMLAEKLLQANKLHSRGEVEDVFFDTHSLNMHTPQFRST
LPSSIEVREDQPVGSSIILMNATDLDTGFNGKLVYVISGGNEDSSFIVDMESGMLKILSP
LDREVKDKYNLNVTVYDLGIPQKSAWHLLDIRILDANDNPPEFLQDSYFVEVSENKELDS
EIIQIEATDKDLGANGEVKYSLLTDTDKFAINAVTGVVKVVGLLDHEEQHIYFLKIEARD
QPTEEPQLFSTVILKVSIEDVNDNPPKFIPSNYHVKIREDLPEGTIITWLEAYDPDVGQS
SQVRYSLLDSGDGTFDVDKLSGAIRIVQRLDYEKKQLYNLTVRAKDKGKPISLSSTCYVE
VEVVDVNENLHPPRFSVFADKGFVKEDAPIGSSVMTVSAYDEDEGRDGEIRYSIRDGSGM
GVFRIDEEKGIIETADHLDRETTSHYWLTVYATDQGVVPLSSFIEIYIEVGDVNDNAPQT
TEPVYYPEVMENSPKDVSVIQIEAFDPDSSSSEKLTYKITSGNPQGFFSINPKTGLITTT
SRKLDREQQAEHILEVTVTDNGIPAQSTVARVIVKVLDENDNKPQFLQKFYKIRLPERGK
PERERTARREPIYRVIAADKDEGPNAEISYSIEDGDEHGKFFIEPKTGVVSSKKFSAARE
YDILSIKAVDNGRPQKSSTTRLHIEWIPKPIPPTEPIYFEEEFFSFTVMESDPVAHMIGV
IAVEPLGIPLWFDITGGNYDSRFDVDKGTGTIIVARPLDAEQKSNYNLTVEATDGTRSIS
TQVYIKVIDTNNHRPQFSASKYEVVIPEDTVPETEILQVSATDRDEKNKLIYTMQGSTDP
ISLKKFRLDPGTGSLYTTEKLDHETMNQHILTVMVRDQDVPVKRNYARVIINVSDTNDHA
PWFTSSSYEGRVYESAAVGSAVLQVTALDKDKGKNAEIVYSIESGNIGNSFMIDPILGMI
KIAKELDHSNQEEYNLMVKATDKGDPPMNEVTSVHIFVTVSDNASPKFTAKEYSTEISES
ASIGSFVGMVTAYSLSSVVYEIKDGNIGDVFAINPNSGVIVSQKVLDFETLPVYTLTVQG
TNMAGLSTNATVLVHLQDENDNIPIFMQSEYTGLISESASVNSVVLTDKNVPLVIQATDA
DKESNALLVYQIVEPSVRKYFAIDSSTGAIRTLMSLDYEETNIFHFSVQVHDMGIPRLYA
EYAANVTIYVVDINDCPPVFSRELYDTSILVPTYKGVKVISVNATDADSGIFSQLIYSII
EGNIGEKFTINPKTGDITVQNTTQLRSRYELTVRASDGRFASTASVKINVKESKVSQLKF
TQSSYSAVVQENSTEAKTIAVVTAIGNQINEPLFYHILNPDSRFKISPTSGVLSTTGIPF
DREQQESFDVVIEVTEEHKPSVVAHVVVKVTVEDVNDNAPSFVNLPYYAAVKVDSEVGYV
IRRVTAVDKDAGRNGEVHYYLKEHHEHFQIDPSGEISLKKKFEPDTVNKEYLVTVVAKDG
GEPAFSAEVIVPITVMNKAMPVFEKPFYSAEIPENIQLHSPVVHVQANSPEGLKVFYSIT
DGDPFNQFMINFNTGVINVVAPLDFESHPAYKLNIRATDSLTGAHADVFVDIIVEDINDN
APVFTEQSYAVTLSEASVIGTPVVQVSATDADSGTNRGISYHLVEDDTESHDYFHIDSST
GLILTTRALDYEKIQQHKLLIRAVDGGMLPLSSDTVVTVDVTDLNDNPPLFNQLVYEAKI
SELAPRGHFVTCVQASDADRSDADKLEYSILTGNDQKNFIINSKTGIITISNLRRQALKS
HYILNVSVSDGVFRSSAQVHVTVTSANMHSPVFSQNEYEVELAENAPLHTLVTVVRARDE
DSGTYGHITYHIINDFAKDRFYISERGQIFTSEKLDRETQAEKVIAISLMAKDSGGKVAF
CTVNVILTDDNDNAPQFRATEYEVNIGSDVPRGTSVIKVWASDADEGTNADITYTIEAES
ENVKENLEIDSLSGIITTKESLIGLENEFLTFFVRAVDGGSPQKESVVPVYARILPPEVS
LPKFSEPFYSYMVSEDIPVGTEIDVIKAEHNQTLVYSLIKGNTPESNRDNFFVIDRQTGK
LKLEKNLDHETTKWYQFSVLAQYTNEDYNVISSVEVSIQVKDANDNKPVLESNPYEAFIV
ENMPAGTRVIQVKGTDLDSGLNGQVTYSLDPSQELDIIESFAINMETGWITTLKELDHEM
RDKYKITVVAADRGEKIQLSSLAVVEVTVTDVNDNPPRFTAEIYKGTVSEDDPPGGIIAI
LSTTDADTKEVNRQVSYYITGGDLLGQFAVENIQNEWKVYVKKPLDREEKDHYLLNITAT
DGTFATRAVVEVKVLDANDNSPVCEKALYTDTVPEDALPGKLIMQVSATDADIRSNAEIT
YTLHGPGAEKFRLTADTGELKTLMPLDREQQAVYYLLVKATDGGGRFCQANIILTLEDVN
DNAPEFTVDPYSITVFENTEPKTLLTRVQATDADAGMNRKIHYSLVNSAEGQFSIDEFSG
IIRLEKPLDRELQAVYTLTLRATDEGLPRRLSSTSNLIVSVLDINDNPPVFEYREYSASV
SEDTVVGTEVLQIHAASRDIEANAEITYSIVSGNEHGKFSIDSTTGAIFIIDSLDYESSH
EYYLTVEATDGGTPSLSDVVTVNINVTDINDNTPVFSQDTYTAVISEDAVLEQSVITVMA
DDADGPSNNHIHYTITDGNQGNPFTIDPSRGEIKVTKLLDREKISGYTLTVQASDNGSPP
RRNTTTVNIDVSDVNDNPPVFSKGNYSIIIQENKPVGFSVLQLVVTDKDSSHNGPPFLFT
ILSGNEENTFQVNHQGVLTTTAALNRKLRDHYLLHVKVTDNGKPPLSSLTYVDIRVIEES
IYPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLTYSLDPKMESMFSVSSTGGKL
IAHKRLDVGQYLLNVTVTDGKFTTAADITVHIKQITQDLLNHSITIRFANLAPEEFIGDY
WRNFQRALRNILGVRRNDIQIVSLQPSDRPSNLDVLLNIEKSGSSQHPMRILLHKINSSV
PDLEEILGVRIIDVFHKLCAGLDCPLKFCEEKVTLDENIMSTHSTARLSFVTPRHHRAAV
CLCKEGRCPVANSACEGNPCPEGTECIGDPKEGKYTCVCHDSKTGQCPASVGSAVTFSGN
SYVKYRLMENENKEEMKLTMRLRTYSAHAVVMYARGTDYSILEIHHGRLQYKFDCGSGPG
IVSVQSIQINDGQWHSVSLEVDGNYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHIR
QQGTRHGRSPQVSNGFRGCMDSIVLNGQELPLNSKPRNYAHMEESVDVTPGCILTTTEGC
SSNPCQNGGICNALSNGGYYCKCAPLFMGTHCDVSVNPCASNPCLYGGTCIPVSDDFICQ
CRGQYAGQRCQLGPYCKDNPCKNSGKCIDSLDGPVCECEAGFRGERCLTDIDECTENPCL
NGALCENTYGSYHCNCSHGFGGKHCTDIVLNKYVSTSWNISLAEVIGIIVFIAGIFLLVG
IFVVCRKVMNRKKKHQPEPEDKQLGATTAFLQRPYFDAKLNKNIYSDVPPQVPVRPISYT
PSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPDSVHGHRKAVAVCSVAPNLPPPPPSNSP
SDSDSIQKPSWDFDYDTKVVDLDPCLSKKPLDEKSSHPYSARESMSEVQSLSSFQSESCD
DNASVVTVIHLVNAVVDSVEKEESFAVPDLSNSRGYHWDTSDWMPSVQLPGIQEYPNYEV
VEESAPLYTDPNAIDTDYYPGGYDIESDFPPPPDDFPAPDELPPLPPEYSDQFESIQPPR
DMPAVGSLGSSTRSRQRFNLNQYLPHHYPADMSEPQTTTSGANGNYREPYAPYTLGYNRD
FEAPTVDNMSMSVYASTASCSDVSACCEMESEVMMSDYESGDDSHFENVKIPPLDSQQHT
EV
NT seq 13869 nt   +upstreamnt  +downstreamnt
atgggaagatacttgactatgctcttgctgctgatgctgctggtgcagcatattggaaac
tgtgaaggaaatcaaataccacatcatgcttcaccaatgcagtttacacaagcacagtat
aatgcaactgtgtatgagaattctgcagccaaaacttacgttgggcatccagtgaaaatg
ggcatttatattgtaaatccattatgggacctaaggtacaaaattatttctggtgacaat
gagaacttgttcaaagctgaagaatatgttcttggaaacttttgttttttgagaatacgg
accaagggaggaaacacagctatccttaacagagaggtaaaagaccattatatgctgact
gttaaagcagttgaaaaaaatacaaatgctgaaacgcgcacgaaggtcagggtacaggta
ctggatacaaatgacttgcggcctttgttttctccgacatcttacagcgtttctttgcct
gaaaacacagcaataaggaccagcatcgcaagagtcagcgcgacagatgccgatatagga
acaaatggggagttctactatagctttaaagaaagaacagatgtatttgctatacatcct
actagtggtgtggtagttctaactggtaggcttgactacttggacactaagctttatgag
atggaaattcttgctgtggaccgtggactgaagctgtatggtagcagtgggatcagcagt
atggctaaactaactgtttatgtagagcaagcaaatgaatatgcccctgttattacagct
gttacattgactccatcagaatcagacaaagatccaacttacgccattgtaactgtagag
gacaatgatcaaggttcaaatggagaaatagcatcattgaatattgttgcaggtgatcca
cttcaacagttcagaacagtgagatctgtgccaggaggtaaagaatatagaatcaaagct
gttggtcacattgactgggagagccagccttctggatacaaccttacccttcaagctaaa
gataaaggaaatcctccacagttttcatctgtgaaagttgttcatgtgacatcatcacga
tttaagtctggtcccgtcagatttgaaaaagagatatatagagctgaaataagtgaattt
gcccctccaaacacacctgtgataatggtgaaagctctacctagttacccgcatttaaaa
tatgtatttaaaaatacacctggcaaagtaaaattcaatttaaacactcatactggtctt
attaccacttcagaacccataaaagcacaatactcctcccactttgaacttgaggttgtg
acaagtgacagaagagcttcagcaaaagtattaattaaggtactaggcatgaacagtaat
cctcctgaatttactcagacagcctataaagcttcctttgatgagaatgtgccaataggt
acgagtgtcatgagagtgagtgcaaaagatcctgatgaaggggagaatggttatgtgacc
tacagtattgcaaacctaaatcctttaccatttgtgattaaccatttcagtgggattatt
agtacgtcagaagacttggattatgaattgatgccaagggtttacaatttaaggattcga
gcttctgattggggtgtaccatatcgtcgagaagttgaagttcctgtgactattatttta
aacaacctgaatgataatatacctctgtttgagaaaattaattgtgagggaacaattccc
agggatcttggtgttggagaacaaataacaactgtatctgccattgatgctgatgagctc
cagttagtaagataccaaattgaatctggaaatgaactggatttatttagcctaaatcca
aattctggtgtactttcactcaagcagtcgctaacagatggcccaggtgctaaaatgtct
tttcacagtttgaaaattacagctacagatggagaaaactttgcaaaaccattgtatatc
aacatcactgtagctactggtcgcaagctggtcaacttgcaatgtgaagaaactggtgtt
gccaaaatgcttgcagagaagctcctacaagcaaataaattgcacagtcgtggagaagtt
gaggatgttttctttgacactcactccttgaatatgcatacacctcagtttagaagtact
ctccccagtagtattgaggtaagagaggatcaacctgtgggctccagcataatacttatg
aatgctactgatcttgatactggcttcaatggaaagttagtatatgttatctctggaggt
aatgaagacagcagtttcattgttgatatggaaagtggaatgctgaaaattttgtctcca
cttgaccgagaagtaaaagataaatataatctgaatgttactgtctatgatcttggaata
ccacagaagtctgcctggcaccttctagatataagaattttggatgctaatgataaccca
ccagagtttctacaagacagctattttgtggaagtgagtgaaaacaaagagctagacagt
gaaattattcaaattgaagctactgataaagatttaggggctaacggagaagtgaaatat
tctcttcttacagatactgacaagtttgctattaatgctgtgacaggagttgtgaaagtt
gtagggcttctggatcatgaagagcaacacatctatttcttgaaaatagaggctagggac
caacctactgaagaacctcagttattttcaacagttattttgaaagtctctatagaagat
gttaatgataatcctcctaagtttattccttcaaattatcatgtgaaaattcgagaagat
cttcccgaaggaacaattatcacgtggttagaagcctatgatcctgatgtaggccagtca
agtcaagtacgatacagtcttttggacagtggggatggcacttttgatgttgataaacta
agtggagcaatacgtattgtacaaagactggattatgaaaagaaacaactttataatttg
actgtgcgggccaaggacaaaggaaaacccatttcattatcttctacgtgttacgttgag
gttgaggtagttgatgtgaatgagaacttgcaccctccacggttctctgtatttgcagat
aaaggctttgtaaaagaagatgcccctattggttcctcagtaatgactgtatctgcttat
gatgaagatgaaggacgagatggggagataaggtattccatcagagacgggtctggtatg
ggagtttttcgaatagatgaagaaaaaggcattattgagactgctgatcacctggatcgt
gagactacttcacattactggttgactgtttatgcaacagaccaaggtgttgtgccatta
tcatctttcattgaaatctacatagaagttggggatgttaacgataatgctcctcagact
acagaaccagtttattacccagaggtcatggaaaactcacctaaggatgtatccgtcatt
caaattgaggcatttgatccagattctagctcaagtgaaaaattaacatacaagatcaca
agtggaaatccacagggattcttttcaataaaccccaaaactggtctaattacaaccaca
tctagaaaactagatcgggagcagcaggcagaacacatattggaggtaacagtaacggac
aacggtattcctgcccaatcaacagttgcacgggtgattgtaaaggttttagatgagaat
gacaataagcctcagttcttgcaaaagttctacaaaatcagactccctgagcgcggtaag
ccagaacgagagaggactgctaggagagagccgatctaccgagttattgctgcagataag
gatgaaggccccaatgcagagatctcttatagcattgaagatggagatgaacatggcaaa
ttctttattgaaccgaaaactggagtggtttcatcaaagaaattttctgcagcaagggaa
tatgatattctttcaattaaagctgtagataatggtcgaccacaaaaatcatcaactaca
cggcttcacatagaatggattccaaagcccatcccacccacagaacccatttattttgag
gaagaatttttttcttttacggtgatggaaagtgacccagttgctcacatgattggtgta
atagctgttgaacctcttggaataccactttggtttgacataacgggtggcaactatgac
agtcgatttgacgtggacaagggtactggaactatcattgttgctagacctcttgatgca
gaacagaaatcaaattacaacttgacagtggaggcaacagatggaaccagatctatcagc
actcaggtgtacatcaaagttatagacacaaataatcacaggcctcaattttctgcttca
aaatacgaagttgttatacctgaagacaccgtaccagagacagaaattttgcaagttagt
gccacagacagagatgagaagaataaactgatatatacaatgcaaggcagcactgatccc
atcagccttaaaaaatttcgtctggaccctggaactggatctctttataccacagaaaaa
ctagatcatgagaccatgaaccagcatattctcacagtaatggttcgagatcaagacgtt
cctgtaaaacgcaactacgctagggtcatcattaacgtcagcgacacaaatgaccatgca
ccatggttcaccagctcttcctatgaaggccgtgtgtatgagtcagcagctgttggatcg
gcagtcctccaggttacagcattagataaggacaaaggaaaaaatgcagaaattgtatat
tctattgaatcagggaatattggaaattccttcatgatagatcccatcttgggtatgatt
aaaattgcaaaggaattagatcatagtaaccaggaagagtacaacttgatggtaaaagct
acagacaaaggagatcctccaatgaatgaagtgacttctgtgcatatatttgttacagtt
tctgataatgcctcaccaaaatttacagccaaagaatattctacagaaatcagcgaaagt
gctagcattggcagttttgttggaatggttacagcatacagtctctcttctgtagtttat
gaaataaaagatggtaatataggagatgtcttcgctatcaacccgaactcaggtgtcatt
gtttcgcagaaggtgcttgattttgaaactttgcctgtttacacgctaactgtgcaggga
acaaacatggctggcttgtccactaatgcaacagttttggtacatcttcaggatgagaat
gacaatataccaatttttatgcagtctgaatatacaggactcatcagtgaatcagcttca
gttaacagtgtggttctgactgacaagaatgtcccattagtaattcaagctacagatgct
gataaagaatcaaatgctttgcttgtttatcaaattgttgaaccatctgttcgcaagtat
tttgccattgattctagcactggtgccattcggacattaatgagtctggactatgaggag
acaaatattttccacttttctgtacaagtgcatgatatgggcattcctcgtttatatgcg
gaatatgcagctaatgttactatttatgtagttgacatcaatgattgtcctcctgtgttt
tcaagagagctgtatgacacatctattttggttccaacctataaaggtgtgaaagtcatc
agcgtaaatgccactgatgctgattcgggcattttttcacaactgatttattccattatc
gaaggcaacattggagaaaaatttacaataaatcccaagactggagatataacagtacaa
aatacaactcagttacgaagcagatatgaattaacagtgagagcatctgatggcagattt
gcaagcactgcatctgtaaaaattaatgtgaaagaaagcaaagtaagccagctgaaattt
acacagagttcttactctgcagtagtgcaggagaattccactgaggcaaaaacaatagct
gtggttactgctatagggaatcaaataaatgagcctttgttttatcatattctaaaccca
gatagcagatttaaaataagcccaacttcaggagtcctttcaacaacaggaataccattt
gatcgtgaacagcaagaatcttttgatgtggtcatagaagtgacagaggaacataaacca
tcagttgttgcacatgttgtagttaaagtcacagtggaagatgtaaatgataatgctcca
tcttttgtcaatcttccatattacgcagcagttaaagtagactctgaagtaggctatgtt
attcgacgtgtcaccgctgtagataaagatgcaggcagaaatggagaagtgcattactat
cttaaagagcatcatgaacatttccagattgatccctctggtgaaatctctctgaagaag
aaatttgaaccggacacagtaaataaggagtacctggtcacagtagtggcaaaagatgga
ggagaacctgctttttctgctgaagttatagtcccaattacagttatgaataaagctatg
cctgtttttgaaaagcctttctatagtgcagaaataccagaaaatattcagctccatagt
cctgtagtacatgtacaagcaaacagcccagaaggacttaaagtgttttacagcatcact
gatggagatcctttcaatcagttcatgatcaacttcaacactggagtgataaatgttgtt
gcccctcttgactttgagtctcatccagcctacaagctgaatatccgagcaacagactcc
ctaactggagcgcacgctgatgtgtttgtggacataatagtggaagacatcaacgacaat
gctccagtattcacagagcagtcttatgctgtaactctttctgaggcatcagtcattgga
acacctgttgtacaagtgagcgctacagatgctgattctggaacaaacaggggaatttcc
tatcatttggttgaggatgatactgaaagtcatgactacttccacatagacagcagtact
ggactcattctcacaacaagagctttggactatgaaaaaattcaacaacacaagttacta
ataagggccgtagatggtggcatgctgcccttgagcagtgacactgttgtaactgttgat
gtgacggatctaaatgacaaccctcctctttttaaccaattggtttatgaagctaaaatt
agtgaactggctcctcgtggacattttgtgacgtgtgtgcaagcctcagatgcagatagg
tcagatgctgacaaactggagtactccattctgacaggcaatgaccaaaagaatttcata
attaatagtaaaactggcataatcaccatctcaaacctacgcaggcaggcactgaagtca
cattatattcttaatgtgtctgtttctgatggagttttcaggagctcggcccaagttcat
gtaactgtaaccagtgccaatatgcatagccctgtttttagccagaacgaatatgaggtt
gaactagctgaaaatgctccattgcatacattagtgactgtggttagagcaagagatgaa
gattctggtacttatggccatatcacttaccacattattaatgattttgccaaagataga
ttttatataagtgagagagggcaaatttttacctctgaaaagcttgaccgtgaaacacaa
gcagaaaaagtaattgccattagtttaatggccaaagattcgggaggaaaagttgctttc
tgtacagttaatgtaatacttacagatgacaatgataatgctccacaatttcgagcaacg
gagtatgaagtaaatattggatctgatgttccccggggaacttctgtcattaaagtctgg
gcgtctgatgccgatgagggtacaaatgcagacatcacatatactattgaagccgagtct
gaaaatgttaaagagaatttagaaattgattctttgtctggtataattacaacaaaagaa
agcttaattggtttagaaaatgagtttctaaccttttttgttagagctgttgatggcgga
tccccccagaaagagtcagttgttcccgtttacgctagaatactcccaccagaagtgtct
cttccaaaattttcagaaccattttattcttacatggtttcagaggacattccagttgga
actgagatagatgttatcaaagcagagcataatcagactttggtgtatagtctgattaaa
gggaacactcctgaaagcaatagagataatttttttgtgattgatcgacagactggaaag
ttgaaacttgagaagaatcttgatcatgaaacaactaaatggtaccagttctcagtgcta
gcacagtatacaaatgaagattataatgttatttcctcagtagaagtaagcattcaagta
aaagatgcaaatgataacaaaccagttttggaatccaatccatatgaagcattcattgta
gaaaacatgccagctggaacaagagtgatccaagtaaaaggaactgacttagattcagga
cttaatgggcaggtcacttacagcctagatccttctcaagaactagatattatagagtcc
tttgccataaacatggaaactggctggattaccactctcaaggaacttgaccatgagatg
cgagacaaatacaaaattacagtggttgcagctgatcgaggtgaaaaaattcagctgtct
tctctggctgtggttgaagttactgttacagatgtgaatgacaatcctccacgctttact
gcagagatatataaaggaacagtcagtgaggatgaccctcctggtggaataattgccatc
ttaagtacaactgatgctgatacaaaagaagtcaatagacaagtctcttactacattaca
ggaggtgatctcttgggacagtttgctgttgagaatattcagaatgaatggaaagtttat
gtcaaaaagcccctggacagggaagaaaaggaccattaccttctaaatattacagctact
gatggaacatttgctactagagctgtggtggaggttaaagtgcttgatgctaatgacaat
agccctgtatgtgaaaaggctttatacactgatactgttcccgaggatgcccttcctggc
aaactgataatgcaggtatctgctacagatgcagatattcgttccaatgcagaaattaca
tacacattacatggccctggagcggagaagttcagactcactgcagacacaggtgaactg
aaaacattaatgccactggaccgtgagcagcaagcagtttattaccttctagtgaaagcc
acagatggaggagggagattctgccaggctaatattattctgactctagaagacgtgaat
gataatgccccagagtttacagttgatccttactccattacagtatttgaaaacacagag
cctaaaacgcttttgacgagagtgcaagcaacagatgcagatgcggggatgaaccgtaaa
atccattattcgctggtgaactctgcagaaggccagttctctattgatgaattctctgga
atcatccggttggagaagcctttggatcgggagttgcaagctgtgtacacactgactttg
agggctacagatgaaggtttacctcgaaggctgtcttccacaagtaatcttatagtttcc
gttttggatataaacgataatccacctgtatttgagtatagggagtacagtgcaagtgta
tcagaagacacagtggttgggactgaagttctccagatccatgctgcaagcagggacatt
gaagccaatgctgaaatcacatactcaatagtcagtgggaatgaacatggaaaattcagt
attgattcaacaacaggagccatttttatcattgacagcttggattatgaaagttctcat
gagtattacttgacagtagaagccacagacggaggcacaccttcattaagtgatgtcgta
acagtgaatattaatgtaacagatatcaatgacaacactccagtgtttagccaagacacg
tacactgcagtaatcagtgaggatgctgtgcttgaacaatcagtcattacagttatggca
gatgatgctgatggaccttcaaacaaccacattcactacacaattacagatggcaatcag
ggaaatccttttacaattgacccttcaaggggtgaaataaaagtgactaagcttctggac
cgagaaaagatttcaggatataccttgacagttcaagcttcagataatggaagcccacct
agacgtaacactaccacggttaacattgatgtttctgatgtaaatgacaatcctccagta
ttctcaaaaggaaactatagcattatcatccaggaaaataaacctgttggatttagtgtg
cttcaactggtggtgacagacaaggattcttctcacaatggtcctccttttcttttcacc
attctgagcggaaatgaagagaacactttccaggttaaccatcaaggagtactgacaaca
actgctgctctgaatcgcaaattgagggatcactacttactacatgttaaggtcacagat
aatggaaagccaccgttgtcatctctgacatatgttgatattagagttattgaggaaagc
atttatcctccagcaattctgcccctagaaatcttcattacagcctttggcgaagaatat
tcaggtggtgtcattggaaaaattcatgcaactgaccaagatgtttatgatactttgact
tatagcctggaccccaaaatggaatccatgttctctgtttccagtactggaggcaaacta
atagcacataaaaggttagacgtgggacaatacctcctgaatgtcactgttacggatgga
aaatttacaactgcagctgatattactgtgcacatcaaacaaatcacacaagatttacta
aatcacagcattacaatacgctttgcaaaccttgctcctgaagaattcattggcgattac
tggcgcaatttccagagagctttaagaaacatcttaggtgttaggagaaacgacatccag
attgttagtttgcagccttctgatcgtccttcaaacctcgatgtcctcttgaatattgaa
aaatctggcagctctcagcatccaatgagaattttgctccacaagataaactcttctgtg
cctgacctagaggagattctaggtgtccgcataattgatgttttccataagctttgtgca
ggcctagactgccctttgaaattttgtgaagaaaaagtaacactggatgagaatatcatg
tcaactcacagcacggccaggctgagttttgtcactccccgtcatcacagagcagcagtt
tgtctttgtaaagaagggagatgccctgtggcgaatagtgcatgtgaaggaaacccatgc
cctgaaggtactgaatgtataggagatccaaaggagggaaaatatacctgtgtttgccat
gacagcaaaaccggacagtgtcctgcatcggtgggctctgctgtgacattcagtgggaac
agttatgtgaaatatcgtctcatggaaaatgagaacaaagaagaaatgaagttgacaatg
agacttagaacttactctgctcatgcagttgttatgtacgctcgagggacagactacagt
atcttagagattcatcatggaaggctgcaatataaatttgattgtggcagcggacctggc
attgtctccgttcagagcattcaaattaatgatggccagtggcattcagtatctcttgaa
gtagatggaaattatgcacgacttgttctggacagggtgcatacagcatctggtactgct
cctggtacgcttaggacactgaacctagataatcatgtgttttttggtggtcatattcgg
caacaaggtacaagacatgggaggagtcctcaggttagcaatggtttcagaggctgcatg
gattctattgtacttaatggacaagagctccccttaaacagcaagccacgaaattatgca
cacatggaagaatctgtcgatgtgactcctggatgcatacttactaccacagaaggttgt
tcaagcaacccatgtcagaatggaggcatctgcaacgccctgtcaaatggaggttactac
tgcaagtgtgctccattattcatgggaactcactgtgatgtaagtgtcaacccgtgtgct
tccaatccctgcctttatggaggtacttgcatcccagtcagtgatgatttcatctgtcaa
tgccgaggacagtacgcaggccaaaggtgccagctgggtccatattgcaaagacaatcct
tgtaaaaacagtggcaagtgcatcgacagtttggatgggcctgtttgtgagtgtgaagca
ggctttcggggagaaaggtgtctgactgatatcgatgaatgcacagaaaacccctgtctt
aatggtgccctttgtgaaaatacttacggttcatatcactgcaattgcagccatggattt
ggaggaaagcactgcacagacattgttcttaacaaatacgtttcaacgtcttggaacatt
agtttagctgaagtaattggaattattgttttcatcgctggaatattcttgttagttggg
atttttgttgtttgccgcaaagtgatgaatagaaagaagaaacaccaaccagaacctgaa
gacaagcagctgggagctacaacagctttcttgcaacgaccttattttgatgcaaaattg
aataagaacatctattctgacgtccctccccaggttcctgttcgtcccatttcatacact
ccaagcattccaagcgactccaggaacaatcttgacaggaattcttttgaggggtccgcg
atccctgagcacccagaatttagtacttttaacccagattctgtgcatggccaccggaaa
gctgtagctgtttgcagtgtagcaccaaacctgccacctccacctccctccaactctcct
tcagacagcgattcgatacagaagcccagctgggattttgactatgacactaaagtagta
gatcttgacccctgcctttcaaaaaagcctctggatgaaaagagctcccatccttatagt
gctagagaaagcatgtctgaagtccagtctcttagctccttccagtctgaatcatgtgat
gacaatgcttccgtagtgactgtaatacaccttgtcaatgctgttgttgactcggtggaa
aaagaagaatcttttgctgttcctgacctcagcaattcaagaggttatcactgggataca
tcagactggatgccaagtgttcaactgccaggtatccaggaatatccaaattatgaagtg
gttgaggagtcagctcccctctatacagatccaaatgccatcgacacagactattaccct
ggcggttatgacatagaaagtgattttccacctccacctgatgacttccctgcacctgat
gagcttccaccattaccaccagaatacagcgaccagtttgagtcaatacagcctcccaga
gacatgccagccgtaggtagcttgggttcttctacaagaagcaggcagaggtttaacctt
aatcagtatcttccccatcactatcctgcagacatgtccgaacctcagaccacaaccagt
ggtgccaatggcaattacagagaaccttatgctccttacacattagggtacaatagagac
tttgaagctcccactgtagacaacatgtccatgtctgtgtatgcttccactgcttcgtgc
tctgatgtgtcagcatgctgtgaaatggagtctgaagtcatgatgagtgactatgagagt
ggagatgacagtcattttgaaaatgtgaaaattcctccactcgattcccagcaacataca
gaagtctga

DBGET integrated database retrieval system