KEGG   Gallus gallus (chicken): 395174
Entry
395174            CDS       T01006                                 

Gene name
MTF2
Definition
(RefSeq) metal-response element-binding transcription factor 2
  KO
K11485  metal regulatory transcription factor 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395174 (MTF2)
   03036 Chromosome and associated proteins [BR:gga03036]
    395174 (MTF2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    395174 (MTF2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     395174 (MTF2)
SSDB
Motif
Pfam: Mtf2_C PHD Tudor_2 Prok-RING_1 DUF4537 DUF3682 DUF1325 C1_1 LBR_tudor DUF3573 Chromo
Other DBs
NCBI-GeneID: 395174
NCBI-ProteinID: NP_989839
CGNC: 49199
Ensembl: ENSGALG00000043087
UniProt: Q6X7S8
Position
8
AA seq 595 aa
MRDSTAVGNSLVHKRSPLRRSHKASASSPKLSLRDGQKAKKPLCKFEEGQDVLARWSDGL
FYLGTIKKINKLKQNCFIIFEDSSKSWVLWKDIQTGATESGEMVCTICQEEYSEAPNEMV
ICDKCGQGYHQLCHTPNIDSSVIDSDDKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ
TLPYNATDLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLF
GDRFYTFICSVCSSGPEYLKRLPLRWVDIAHLCLYNLSVIHKKKYFDSELELMAYINENW
DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNAALK
AEKEPEGTSHEFKIKGRKSSKPIPDVRELSNGLERKGKKKSVGRPPGPYTRKMIHKTPES
SPLDTEPVPVIETPALELPCSVGKSDGTAHSSNTSDVESTGAASIKETTSSSISRHYSLS
DSRKRTRTGRTWPAAIPHLRRRGRFPRKALQTQNSEIVKDDESKEDYQYDELNTEILNNL
ADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgagagactctacagcggtgggtaattcactggtccataagcggtctcctttacgtcga
agtcataaggcatcagcatcctcacccaaactatcgttacgtgatggacagaaagccaaa
aagccactgtgtaaatttgaagaaggtcaggatgtcctagctagatggtcagatggcttg
ttttatcttggaactatcaaaaagataaacaaactgaaacagaactgcttcattatattt
gaggacagttccaagtcttgggttctctggaaggacatacaaacaggagccactgaaagt
ggggaaatggtctgtacaatatgtcaggaggagtattcagaagcaccgaatgagatggtt
atatgtgataaatgtgggcaaggttatcatcagctgtgtcacacaccaaatattgattcc
agcgtgatagattcagatgataaatggctctgtcgacagtgtgtttttgcaacaacaact
aagagaggtggtgcgcttaaaaaaggaccaaatgccaaagcactgcaagtcatgaaacaa
actttaccatataacgcaacagaccttgagtgggatgcgggtcataaaaccaatgttcag
cagtgttactgctattgtggaggacctggagactggtatctaaagatgttgcagtgctgc
aaatgcaagcagtggttccatgaggcttgtgtgcagtgcctccaaaagccgatgcttttt
ggtgacaggttttatacattcatttgctcagtttgcagttctggaccagaatacctcaaa
cgtttacccttgagatgggtagatatagcacatctatgcctttacaacctaagtgttatt
cataagaagaaatactttgattcggagcttgaactcatggcgtacataaatgaaaactgg
gatagattacatcctggtgagctggcagatacaccaaaatctgaaagatatgagcatgta
ctggaggcattaaatgattacaagaccatgtttatgtctggaaaagaaataaagaaaaag
aagcatttgtttggcttgagaattcgtgttcctcctgtgccgccaaatgctgctttaaag
gctgagaaagagccagaaggaacttctcatgagttcaaaattaaaggcagaaaatcatct
aaaccaatccctgatgtgagggaattaagtaatggtttagaaagaaaggggaaaaaaaaa
tcagtaggtcgtccacctggtccctatacaagaaaaatgattcacaaaactccagagtcg
tctcctctggatactgaaccagttccagtgatagagaccccagccttggaattaccctgc
tctgttgggaaatccgatggaactgcacattcatccaatacctcagatgtggaatccaca
ggtgctgccagtataaaagaaactacctcatctagcatatccagacattatagtttatct
gattcaagaaaaaggactcgtacaggaagaacttggcctgctgcaataccgcatttgaga
agaagaggtcgctttccacgaaaagcactccagactcaaaattcagaaattgtaaaagat
gatgagagcaaggaagattaccagtatgatgaactcaatacggagatacttaacaattta
gcagaccaggagttacagctcaatcatctgaagaactctattactagttattttggtgca
gcaggtagaatagcttgtggcgaaaagtaccgtgttttggctcgtcgggtgacacttgat
ggaaaggtgcagtatcttgtggagtgggaaggagcaactgcatcctga

DBGET integrated database retrieval system