KEGG   Gallus gallus (chicken): 395177Help
Entry
395177            CDS       T01006                                 

Gene name
BMP10
Definition
(RefSeq) bone morphogenetic protein 10 precursor
  KO
K22670  bone morphogenetic protein 10
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395177 (BMP10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395177 (BMP10)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   395177 (BMP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 395177
NCBI-ProteinID: NP_001264975
CGNC: 60
Ensembl: ENSGALG00000000120
UniProt: F6S3W4
Position
22
AA seq 425 aa AA seqDB search
MDSIVLQLWAGLCLLVHLATCSPILSLEHSSLEEGEPLFDEFLSEQDGVDFNTLLQNMKN
EFLKTLNLSDIPLHESAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLASHPVGV
IGVRKYPLLFNVSIPHHEEITMAELRLYTLVERDQMLYEGLDRKVTIFEVLENDHMGVGE
ERKIVALASRQIYGTSSEWESFEVTEAIRRWRRAGLTTHRLEVHIESREGEEQNGEGKLD
IDINSEAKHVPLLIVFSDDQSNDQKEEKQELNEMIDHEQLLDLENLEVGNFHGHPGEEAL
LQMRSNIIYDSTARIRRNAKGNYCKKTPLYIDFKEIGWDSWIIAPAGYEAYECHGVCAYP
LTEHVTPTKHAIVQTLVHLKNPQKASKACCVPTKLDPISILYMDAGVVTYKFKYEGMVVS
ECGCR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggattccatagtcctccagctgtgggctggcctctgcctcttggttcaccttgccact
tgcagtcccatcctgagcttggagcactcttccttagaggaaggcgagcctcttttcgat
gaattcctgtccgagcaggatggtgttgatttcaacacattgcttcagaatatgaagaac
gagttcctgaagacgttgaacctctccgacattcctctgcacgagtcggccaaagtggac
ccaccagagtacatgttagagctgtacaacaagtttgccactgacaggacatctatgcca
tctgcaaatatcattaggagcttcaaaaatgaagaccttgcttcccaccctgttggcgtc
ataggagttcggaaatacccccttctgttcaatgtctccatccctcatcatgaagaaatc
accatggcggagctgagactctacaccttggtggagagggaccaaatgctttatgaaggg
ctcgaccgaaaggtcaccatttttgaagtgctggaaaatgaccatatgggggtaggagaa
gaaagaaagatcgtggcgctggcatccagacagatctatggcacaagcagtgagtgggag
agcttcgaggtgaccgaagccatcaggcgttggcgaagggcagggctgaccacgcaccgg
ctggaggttcacattgagagcagagaaggggaggagcagaatggagaggggaaactcgat
atcgacatcaactctgaggctaagcacgtgcccctgttgattgtgttctctgatgaccaa
agcaatgatcagaaagaggagaagcaagagctgaacgaaatgatagaccatgagcagctc
ctggacttggagaacctggaagttggcaatttccatggacaccctggtgaggaggctctg
ctccagatgcgttctaacatcatttatgactctactgctcgaatccgaaggaacgcaaaa
ggcaactactgcaaaaagactccactctacatagatttcaaggagattggctgggattcc
tggatcatcgctccagcaggatatgaagcttatgagtgccatggagtatgcgcctacccc
ttaacagagcacgtcaccccaacaaaacatgccattgtccagactttggttcacttgaag
aatccccagaaagcctccaaggcctgctgcgtgcccaccaaactcgatcctatctcaatt
ctctacatggatgcaggggtggtcacctacaagttcaaatatgaaggcatggtggtatca
gagtgtggctgcagatag

DBGET integrated database retrieval system