KEGG   Gallus gallus (chicken): 395179
Entry
395179            CDS       T01006                                 

Gene name
ROR1
Definition
(RefSeq) inactive tyrosine-protein kinase transmembrane receptor ROR1
  KO
K05122  receptor tyrosine kinase-like orphan receptor 1 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395179 (ROR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395179 (ROR1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395179 (ROR1)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  ROR family
   395179 (ROR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Kringle I-set Ig_3 Fz Ig_2 ig V-set TMEM154
Other DBs
NCBI-GeneID: 395179
NCBI-ProteinID: NP_989840
CGNC: 49201
Ensembl: ENSGALG00000011019
UniProt: F1NML5
Position
8
AA seq 896 aa
MPTSSWNISSELDRDYFLTLDEPMNNITTTLGQTAELHCKVSGNPPPTVRWLKNDAPVVQ
EPRRISFRATSYGSRLRIRNLDTTDTGYFQCVATNGRKTVSTTGVLFVKFGPPPTASPGS
SDEYEEDGFCQPYRGIACARFIGNRTIYMESLHMQGEIENQITAAFTMIGTSSHLSDKCS
QFAIPSLCHYAFPYCDETSPAPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP
NCEDLPQPDSPEAVNCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTRSGRQCQPWNSQ
YPHTHTFTAIRYPELNGGHSYCRNPGNQKDAPWCFTLDENFKSEICDVPACDYKDAKEKN
KMEILYILVPSVTIPLAIALLFFFICICRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYK
PKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLIAIKTLKDFNNPQQWAEF
QQEASLMAELHHPNIVCLLGVVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDED
GTVKSSLDHGDFLHIAVQIAAGMEYLSSHFFVHKDLATRNILIGEQLHVKISDLGLSREI
YSADYYRVQNKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQE
VIEMIRKRQLLPCSEDCPPRMYSLMTECWHDLPSRRPRFKEIHTRLRSWEGLSSHTSSTT
PSGGNATTQTTSLSASPVSNLSNPRYPNYMFPAQGIPQGQIAGFIGPPIPQNQRYIPING
YPIPAGYAAFPAAHYQPQGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEAN
IPLLSHMSIPSHPGGIGITVFGNKTQKPYKIDSKQSSLLGDSSIHGPNESVISAEL
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgcctacgtcatcatggaacatctcgagtgagctagatagagattacttcttgacgctg
gacgagcccatgaacaacatcaccaccactcttggccagaccgcagagctgcactgcaag
gtctccggcaatccgccgcccaccgtgcgctggctgaagaacgacgctcccgtggtccag
gagccccggcgcatctccttccgtgctaccagctacggctcccggctccgaatcagaaac
ctggacactaccgacaccggctacttccagtgcgtcgctacgaatggcaggaagactgtt
tctaccaccggtgtgctgtttgtcaaattcggtcccccaccaacagcaagtccgggatca
tcggatgaatacgaagaggatggtttttgccagccctaccgggggatcgcttgtgcacgg
tttattggaaatcggaccatttatatggagtctttgcatatgcaaggtgaaatagaaaat
cagatcacagctgccttcaccatgattggcacttccagccatttgtcggataaatgctcc
cagtttgctattccttcactctgccactacgccttcccctactgcgatgagacttcccca
gctcccaagccacgagacctgtgccgcgacgagtgtgaaattctggaaaatgtcctgtgt
cagacagagtatatttttgctagatccaatcccatgattctgatgagattaaagctgccc
aactgtgaagatcttccccagccagatagccccgaagccgtcaattgtatccggattggg
attcccatggcagatcccataaataaaaatcacaaatgctacaacagcacaggggtggac
taccggggcacggtgagtgtgaccaggtcagggcggcagtgccagccgtggaactcgcag
tacccgcacacgcacaccttcactgccatcaggtacccggagctcaacggggggcactcc
tactgccgcaaccccggcaaccagaaggacgccccgtggtgcttcaccttggatgagaat
ttcaagtctgagatctgtgacgtcccagcatgtgactataaggatgccaaagaaaagaac
aaaatggaaatcctgtacatcctggtgccaagtgttactattcccctggccatagcattg
ctcttcttcttcatctgcatttgtcgcaacaaccagaagtcgtcctcccctccagttcag
agacagccaaaacacgtcagagggcagaatgtggagatgtcaatgctcaacgcctataaa
ccaaagagcaaggctaaggagttgcctctctctgctgttcgtttcatggaagaactgggt
gaatgtgctttcggcaaaatctacaagggacacctctaccttccaggcatggaccacgct
cagctcattgcaatcaagacactaaaagactttaacaacccccagcagtgggcagagttc
cagcaagaagcatctcttatggctgagctccaccaccctaacattgtttgcctcttaggt
gtggtgacccaggagcaacctgtctgcatgctcttcgagtacatgaaccaaggagacctc
cacgagttcctcatcatgagatcaccacactcagatgttgggtgtagcagcgatgaggat
ggaactgtaaaatccagcctggaccatggggatttcctgcatattgcagttcagattgca
gcagggatggaatacttatcaagccatttctttgtccataaagatctcgccactcgtaac
attttaattggagaacagcttcatgtgaaaatttcagaccttggactctcaagagaaatc
tactcagcagattattacagagttcaaaacaaatctcttctgccgattcgctggatgcca
ccggaggcgattatgtatggcaagttctcttctgattcagatatttggtcattcggagtg
gttttatgggagatattcagctttggacttcaaccatattacggatttagtaatcaagaa
gtcatagagatgatcaggaagcgacagctgctgccgtgctctgaagactgtcctcctcga
atgtacagcctgatgacggagtgctggcacgacttgccctctcggaggccgcgatttaaa
gaaatccacaccaggctgcgctcctgggagggcctttcaagccacactagttctaccacc
ccctcaggtgggaatgccaccactcagacaacttccctcagcgcaagccccgttagtaac
ctgagtaatcccaggtaccctaactacatgtttccagcacaaggtataccacaaggccaa
attgccgggttcatagggccgcccatacctcaaaaccagcgatatatcccgatcaacggg
tacccaattccagcaggatacgccgctttcccagctgcccactaccagccgcagggcccg
cccagggtaatccagcactgtcctcctccaaagagccgttctcccagcagtgccagcgga
tccactagcacaggtcacgtcacaagtttgccatcttcaggatccaaccaggaggcaaac
atccctttgctatcccatatgtcgattcccagtcatccgggcggaattggtataaccgtt
tttggaaacaaaactcaaaaaccatacaaaattgactcgaagcagtcttccctattagga
gactcgagcatccacggacctaatgaatctgtgatttcagctgaattgtaa

DBGET integrated database retrieval system