KEGG   Gallus gallus (chicken): 395180
Entry
395180            CDS       T01006                                 

Gene name
CXCL12
Definition
(RefSeq) stromal cell-derived factor 1 precursor
  KO
K10031  C-X-C motif chemokine 12
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04672  Intestinal immune network for IgA production
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395180 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    395180 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    395180 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    395180 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    395180 (CXCL12)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Chemokines
   395180 (CXCL12)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Chemokines
   395180 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 395180
NCBI-ProteinID: NP_989841
CGNC: 66195
Ensembl: ENSGALG00000041346
UniProt: Q6T7C0
Position
6
AA seq 89 aa
MDLRALALLAFALAVISLSEEKPVSLTYRCPCRFFESNVARANIKHLKILSTPNCSLQIV
ARLKSNSKQVCIDPKLKWIQEYLEKALNK
NT seq 270 nt   +upstreamnt  +downstreamnt
atggacctccgcgccctggctctgctcgcctttgccctggcagtcatctccctgtcggag
gagaagcctgtcagcctgacttaccgatgcccctgtcgattcttcgagagcaacgtggcg
agggccaacattaagcacctcaaaatcctttccactcccaactgctcgcttcagattgtt
gcaaggctcaagagcaacagcaagcaagtgtgcattgatcccaagctaaaatggatccag
gaatatctggagaaagctttaaacaagtaa

DBGET integrated database retrieval system