KEGG   Gallus gallus (chicken): 395183
Entry
395183            CDS       T01006                                 

Gene name
BSX
Definition
(RefSeq) brain-specific homeobox protein homolog
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 395183
NCBI-ProteinID: NP_989843
CGNC: 4913
Ensembl: ENSGALG00000006515
UniProt: Q6RFL5
Position
24
AA seq 233 aa
MNLNFTSPVHPVPAPRPTSFFIEDILLHKPKPLREVPPEHFAGSLASRVPLLDYGYPLMP
APALLAPHPHPALHKPEHHHHHPYFLTTSGVPVPALFPHHAHAELPGKHCRRRKARTVFS
DSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDDPIH
EENREQSSPEPELPEPAAAEPRKGPPGPFLLQDPEDEVDILEEGDILAAPHRL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaacctcaacttcacctctccggtacacccggtccccgcgccccgacccacctccttc
ttcatcgaggacatcctgctgcacaagcccaagcccctgcgggaggtgccccccgagcac
ttcgccggctccttggcatcccgcgtcccgctcttggactatgggtaccccctgatgccc
gccccggcgctgctggctccacacccgcacccggccctgcataaaccggagcaccaccac
caccacccctacttcctcaccacctcgggagtgccggtgccggcgctgttcccgcaccac
gctcacgccgagctgcccgggaagcactgccgccgccgcaaggcccgcaccgtcttctcc
gactctcagctctccggtctggagaagcgcttcgagatccagcgctatctctccacgcca
gagcgggtggagttggccacggcgctcagcctctccgagacgcaggtgaaaacctggttc
cagaaccggcggatgaaacacaaaaaacagctgcggaaaagccaggacgaccccatacac
gaagagaaccgcgagcagagctcccccgagcccgagctccccgagccggccgcagccgag
ccccgaaagggcccccccggccccttcttgctgcaggaccccgaggacgaggtggacatc
ctggaggagggggatatcctcgccgccccacaccgcctttag

DBGET integrated database retrieval system