KEGG   Gallus gallus (chicken): 395186
Entry
395186            CDS       T01006                                 

Gene name
IL17RD
Definition
(RefSeq) interleukin-17 receptor D precursor
  KO
K05167  interleukin 17 receptor D
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:gga04050]
    395186 (IL17RD)
Cytokine receptors [BR:gga04050]
 Interleukin receptor families
  IL17 receptor family
   395186 (IL17RD)
SSDB
Motif
Pfam: IL17R_D_N SEFIR TIR_2 DUF2141
Other DBs
NCBI-GeneID: 395186
NCBI-ProteinID: NP_989846
CGNC: 4095
Ensembl: ENSGALG00000005499
UniProt: Q7T2L7
Position
12
AA seq 741 aa
MAPGRELGAFLLALLAFCGGRRLAEAAGGPGGRRGAAADACGGRGLSSVTKSNGLLNITF
KYDNCTPYLNSVGKHVIGDVQNITISQYACYEQVAVTILWTANAIGIEYLRGFRVILEEL
KSEGRQCQQMVLRDPKQLSPSFKRTGMESNPFANLKFETDYFVKIVPFPSIKNESNYHPF
FFRTRPCELLLQPENLICKPYWKPRNLNVTQQGFNMQVSFDHAPHNFGFRYYFLHYKLKH
EGPFKQKTCKQDQNTDTTSCILQNVTPGDYIIELVDDTNTTRKTMHYALKPVHSPWAGPI
RAIAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESSESSAYGAGLPVERLRPRPKV
FICYSSKDCQKHINVIQCFAYFLQDFCGCEVALDLWEDLKICKESQKEWLIKKINESQFI
IIVCSKGMKYFVEKKNWKHRGVTKDTGKGELFLFAVFTVAEKLRQAKQNSNDLCKFIAVY
FDYSCEGDIPGILDLSTKYKLMDNLPQLYSHLHSRDLSVQDSEVFPVNVSKRNYFRSKSG
RSLYVAICNMHQFIDQEPDWFEKQFIPFLPHPLHYSEPVMEKFDSGLVLNDLVNKQAADD
DFYLKTDVNIISAGSSDSHCIIQHLNLGEDVETQDIQRGGSSVLRPLLHAVKASNLKDMP
RDSGIYDSSVPSSELSLPLMEGLLTDQTETSSITGSVSSSSGLGEEEPPVITSTKFLLPG
ICKAELHCHIHTDELQAIAPL
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggccccggggcgggagctcggcgccttcctcctcgctctcctcgccttctgcggggga
cggcggctcgcggaggcggccggagggcccggcggcaggaggggggcggcggccgacgcc
tgcggagggcggggcctgtcatctgtcaccaagagcaatgggcttctcaatatcaccttt
aaatatgacaactgcactccttacctgaattcagtgggaaagcatgtgattggagatgtg
cagaatataacaatcagtcagtatgcatgttatgaacaagttgcagtcacaatactttgg
acagcaaatgccattgggattgaatacctgagaggattccgtgtaatacttgaagagtta
aaatcagagggaaggcaatgtcagcagatggttttaagagatccaaagcagctcagccca
agttttaaaagaacaggaatggaatccaatccctttgcaaatctgaagtttgaaacagat
tactttgtcaagattgtgccttttccttccattaaaaatgaaagtaattatcacccattc
tttttccgaactcggccatgtgaattattgctacagccagaaaacctcatctgcaaacct
tactggaagccacggaatctgaatgttacccagcagggttttaatatgcaagtgtctttt
gatcatgctccccacaactttggatttagatattactttcttcactacaaactgaagcat
gaagggccattcaagcaaaagacctgcaaacaggatcaaaacacagatactacaagttgt
attcttcagaatgtaactccaggggattatatcatcgagctggtcgatgacactaataca
acaagaaaaacaatgcactatgcactaaaaccagtacattctccgtgggctggaccaata
agagctattgccattacagtccctttagttgtcatttcggcatttgcaacacttttcaca
gtgatgtgccgcaaaaagcagcaagagaatatatattcccatctagacgaggagagctca
gaatcttcagcttatggtgcaggtctccctgtggaaagacttcgcccccggccaaaagta
ttcatctgctattccagtaaagattgccagaaacacattaatgttatccagtgctttgct
tattttcttcaggacttctgtggctgtgaggtggctctggatttgtgggaagatctgaaa
atttgtaaagaaagtcagaaagaatggctcattaaaaaaataaatgagtctcagtttatc
atcattgtgtgctccaagggtatgaaatacttcgttgaaaaaaagaattggaaacacaga
ggagtaaccaaagacacagggaaaggagaactctttctgtttgctgtgtttactgttgca
gagaagcttcgtcaagcaaagcagaattcaaatgacctctgcaagttcattgcagtctac
tttgattactcctgtgagggagacattcctggtattctggatctaagtacaaaatataaa
ctcatggacaatctgcctcagctttattcacatttacattccagagaccttagtgtgcag
gattcagaggtgtttcccgttaatgttagtaaaaggaattatttcaggagcaaatctggt
aggtctctttatgttgccatttgtaatatgcatcagttcattgatcaggaaccagactgg
tttgagaaacaatttattcccttccttccacatcctttacattactcggagcctgtcatg
gaaaaatttgactcgggcttggttttaaatgacttagtgaataaacaggcggcggatgat
gatttttacctgaaaacagatgtaaatattatttcagctggaagttcagactctcattgt
ataattcagcacttaaatcttggagaagacgtagaaactcaggacattcaaaggggtggc
agctctgttcttcgaccattgttgcatgctgttaaagcttcaaatcttaaagatatgcct
cgagattctggaatctatgattcgtctgttccttcatctgaactatctttgcctttaatg
gaaggactactgacagatcaaactgaaacatcttccatcacaggaagtgtttcttcatca
tcaggtttaggagaagaagaacctcctgtaatcacttccacaaagttcttactgcctgga
atatgtaaagcagaacttcattgccatatccatactgatgaactgcaggcaattgctcct
ctgtaa

DBGET integrated database retrieval system