KEGG   Gallus gallus (chicken): 395191
Entry
395191            CDS       T01006                                 

Gene name
OTX2
Definition
(RefSeq) homeobox protein OTX2
  KO
K18490  homeobox protein OTX2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395191 (OTX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    395191 (OTX2)
SSDB
Motif
Pfam: TF_Otx Homeodomain NUDE_C SatD
Other DBs
NCBI-GeneID: 395191
NCBI-ProteinID: NP_989851
CGNC: 66196
Ensembl: ENSGALG00000034889
UniProt: Q6E236
Position
5
AA seq 289 aa
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKNSPARE
VSSESGTSGQFTPPSSTSVPTISSSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYT
QASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGANAVTSHLNQSPASLST
QGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatgtcttatcttaagcaaccaccttacgcagtcaatggcctgagtctcaccacctcg
ggcatggatttgttgcatccgtccgtcggttatcccgccaccccccgaaagcagcggcgg
gagcgcaccaccttcacccgggcgcagctggacgtgctggaggccctgttcgccaagacc
cgctaccccgacatcttcatgcgggaggaggtggccttgaaaatcaacctgcccgagtcc
agagtgcaggtgtggttcaaaaaccgccgggccaagtgccggcagcagcagcagcagcag
cagaacgggggccagaacaaggtgaggccggccaaaaagaagaactcgccggcccgggaa
gtgagctcggagagcgggaccagcgggcagttcacacccccctccagcacctcggtcccc
accatttccagcagcagtgcccccgtgtccatctggagcccggcgtccatctccccgctc
tccgatcccctgtccacttcttcctcctgcatgcagaggtcctaccccatgacctacacc
caggcatcaggttacagccaaggatatgccggctcgacctcctatttcggagggatggac
tgtggatcttatttgacccctatgcaccaccagctccccggaccgggggccaccctgagt
cccatgggtgccaatgcggtcaccagccacctcaaccagtctccagcctccctctccacc
cagggctatggagcctccagtttgggctttaactcgaccaccgattgcttggattataaa
gaccaaaccgcctcctggaagttaaacttcaatgctgactgcttggattataaagaccag
acatcctcatggaagttccaggttttgtga

DBGET integrated database retrieval system