KEGG   Gallus gallus (chicken): 395198Help
Entry
395198            CDS       T01006                                 

Gene name
CASQ2
Definition
(RefSeq) calsequestrin-2 precursor
  KO
K23445  calsequestrin 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    395198 (CASQ2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395198 (CASQ2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calsequestrin Thioredoxin_6 SDA1
Motif
Other DBs
NCBI-GeneID: 395198
NCBI-ProteinID: NP_989857
CGNC: 49209
Ensembl: ENSGALG00000015018
UniProt: P19204
Position
1
AA seq 406 aa AA seqDB search
MKATCWILAGFCLLFCCKAEEGLNFPTYDGKDRVIDLNEKNYKHALKKYDMLCLLFHEPV
SSDRVSQKQFQMTEMVLELAAQVLEPRSIGFGMVDSKKDAKLAKKLGLVEEGSLYVFKEE
RLIEFDGELATDVLVEFLLDLLEDPVEVINSKLELQAFDQIDDEIKLIGYFKGEDSEHYK
AFEEAAEHFQPYVKFFATFDKGVAKKLGLKMNEVDFYEPFMDEPVHIPDKPYTEEELVEF
VKEHKRATLRKLRPEDMFETWEDDMEGIHIVAFAEEDDPDGFEFLEILKQVARDNTDNPD
LSIVWIDPDDFPLLITYWEKTFKIDLFRPQIGIVNVTDADSVWMEIRDDDDLPTAEELED
WIEDVLSGKINTEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgacttgctggatcctggcaggcttttgcctgcttttctgctgcaaggcagaa
gaaggactgaatttccccacgtatgatgggaaagaccgagtgatcgacctgaacgagaag
aactacaagcatgccctgaagaagtatgacatgctttgtctgctcttccacgagcctgtg
agctccgacagggtgtcccagaagcagttccagatgacggagatggtcctggagctggca
gctcaggttctggagcctaggagcatcggatttgggatggtggattccaagaaggatgcc
aaacttgccaaaaagctaggcttggttgaagagggaagtctctatgtctttaaggaggag
cggttgattgaatttgacggtgaactggccacagatgtcttggtggaattcctcttggat
ctgctagaagaccctgtggaggtcataaacagcaagctggagcttcaagcctttgaccaa
attgacgacgaaatcaaactcattggctacttcaaaggagaagactctgaacattacaag
gcatttgaagaggctgctgaacacttccagccatatgtcaaattctttgccacattcgac
aaaggggttgccaagaaactgggcctgaagatgaacgaggtggacttctatgaaccattc
atggatgagcctgttcacatccccgataaaccttacacagaagaggagctggttgaattt
gtgaaggaacacaaaagagccaccttgcggaagctgcgcccagaagacatgtttgaaaca
tgggaggatgacatggaaggaatccatatcgtggcctttgctgaagaagatgacccagat
ggctttgagttcctggaaatcctgaagcaggttgccagggacaacactgataatcctgac
ctgagcattgtgtggattgaccctgacgactttcctctgctcatcacttactgggagaag
accttcaagattgacctgttcaggccgcagattgggattgtgaatgtcacagacgctgac
agtgtctggatggagatcagagatgatgatgacctgcccacagccgaggagctggaggac
tggatagaggatgtgctttctgggaagataaatactgaagacgatgacgatgatgacgat
gatgatgacgacgacgatgatgatgacgatgatgatgatgatgacgacgatgatgacgac
gatgacgatgatgatgactaa

DBGET integrated database retrieval system