KEGG   Gallus gallus (chicken): 395206
Entry
395206            CDS       T01006                                 

Gene name
CHST10
Definition
(RefSeq) carbohydrate sulfotransferase 10 precursor
  KO
K09674  carbohydrate 3-sulfotransferase 10 [EC:2.8.2.-]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00515  Mannose type O-glycan biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    395206 (CHST10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    395206 (CHST10)
Enzymes [BR:gga01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     395206 (CHST10)
Glycosyltransferases [BR:gga01003]
 Unclassified
  Sulfotransferases
   395206 (CHST10)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 395206
NCBI-ProteinID: NP_001025514
CGNC: 12576
Ensembl: ENSGALG00000016769
UniProt: Q5ZIE4
Position
1
AA seq 358 aa
MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDGYGAKQEPLILTAVTKVEEARVPEEKH
WTKEFQPTGKAFTGNLLHHPLVHMERLELLRNVCRDTALRNLSHTAVSKFVLDRIFVCDK
HKILFCQTPKVGNTQWKKVLIVLNGAYSSIDEIPESIVHDHEKNGLPRLSSFSDSEIKKR
LNLYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPSIIRKYRRNRMETKGLQFE
DFVRYLGDPNHRWLDVQFGDHIIHWVTYVELCAPCEITYSVIGHHETLEDDAPYILKAAG
IDRLVSYPTIPPGITVYNKTKVERYFSGISKRDIRRLYARFEGDFKLFGYRVPDFLLN
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcaccaccagtggctgcttctagctgcatgcttttgggtgatattcatgttcatggtt
gccagcaagtttatcacactgacttttaaagatccagatggctacggtgccaaacaagag
ccattgatactgacagctgtgacaaaagtggaggaggcacgtgtgccagaggaaaaacat
tggactaaagaattccagccaactggaaaagcttttactggaaatctgctacaccatccc
ctcgttcatatggaaagacttgagcttctccggaatgtctgcagagacactgcattgaga
aatctctctcacactgcagtttccaaattcgtcttggaccgaatatttgtgtgtgacaag
cacaagatcctgttttgtcagactccgaaagtgggcaacactcagtggaaaaaagtcttg
atcgttttaaatggagcatattcttccatagatgagatccccgaaagcattgtacatgat
catgagaagaatggccttccacgcctgtcctccttcagtgactctgaaattaaaaagcga
ctgaatttatacttcaagttttttattgttagagatccatttgaaagacttatttctgca
tttaaagacaagtttgtgcacaatcctcgcttcgagccttggtaccgacacgaaattgct
cccagcatcattcgtaaatacagaaggaatcgcatggagaccaaagggctgcagtttgag
gactttgtgcgctacctgggcgaccccaaccaccgatggctggatgtccagtttggtgat
cacatcattcactgggtaacctatgtggaactctgcgccccctgcgaaatcacgtacagt
gtgattggacaccacgaaaccctggaggacgatgctccctacattttgaaagcagccggc
atagaccgtctggtatcataccccacgattccaccaggcataacagtgtacaacaaaaca
aaagtagagaggtatttttcaggaatcagcaagagagacataagacgcctctatgctcgg
tttgaaggcgattttaaactctttgggtatcgggtgccagatttcttgcttaactga

DBGET integrated database retrieval system