KEGG   Gallus gallus (chicken): 395208
Entry
395208            CDS       T01006                                 

Gene name
MAB21L1
Definition
(RefSeq) putative nucleotidyltransferase MAB21L1
  KO
K23092  putative nucleotidyltransferase [EC:2.7.7.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    395208 (MAB21L1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     395208 (MAB21L1)
SSDB
Motif
Pfam: Mab-21
Other DBs
NCBI-GeneID: 395208
NCBI-ProteinID: NP_989864
CGNC: 12813
Ensembl: ENSGALG00000045052
UniProt: Q8AY65
Position
1
AA seq 359 aa
MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMD
NRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITAS
GYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIW
PRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGKQSSAESDAWVLQFAEAENR
LQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRL
NGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgatcgcggcccaggccaagctggtgtaccacctgaacaagtactacaacgagaagtgc
caagccaggaaagccgccatcgccaagacgatccgcgaggtgtgcaaggtggtgtcggac
gtgctgaaggaggtggaggtgcaggagccgcgcttcatcagctccctcaacgagatggac
aaccgctacgagggcctggaagtcatctcccccaccgagttcgaggtggtgctctacctc
aaccagatgggggtcttcaacttcgtggacgacggctccctgccgggctgcgccgtgctg
aagctgagcgacggccgcaagcggagcatgtcgctctgggtggagttcatcacggcctcg
gggtacctctcggcccgcaagatccgctcccgcttccagacgctggtggcccaagccgtg
gataagtgcagttacagggacgtggtaaagatggtggcggacacgagcgaggtgaagctg
aggatcagggacaggtacgtggtgcagatcacgcccgccttcaagtgcacggggatctgg
ccgcggagcgctgcccactggccgctgccccacatcccctggcccggccccaaccgcgtg
gccgaggtgaaggcggagggcttcaacctgctctccaaggagtgccactcgctggcgggc
aagcagagctcggccgagagcgacgcctgggtgctgcagttcgccgaagccgagaacaga
ctgcagatgggcggctgcaggaagaaatgcctctccatcctcaaaacgctgcgggaccgg
cacctggagctgccgggccagccgctcaacaactaccacatgaagactctcgtatcgtac
gaatgcgaaaagcacccgcgggagtcggactgggacgagtcgtgcttgggcgatcggctc
aacgggattttactgcagctcatctcctgcctgcagtgcaggaggtgcccgcactacttc
ttgcccaacttagacctctttcagggcaaacctcactcggccctggaaaacgcggccaaa
cagacgtggcggctggccagggagatactgaccaacccgaaaagtttggagaaactttag

DBGET integrated database retrieval system