KEGG   Gallus gallus (chicken): 395210
Entry
395210            CDS       T01006                                 

Gene name
SPP1
Definition
(RefSeq) osteopontin precursor
  KO
K06250  secreted phosphoprotein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
gga04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395210 (SPP1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    395210 (SPP1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395210 (SPP1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    395210 (SPP1)
SSDB
Motif
Pfam: Osteopontin FAM76
Other DBs
NCBI-GeneID: 395210
NCBI-ProteinID: NP_989866
CGNC: 8301
Ensembl: ENSGALG00000010926
UniProt: P23498
Position
4
AA seq 264 aa
MKLAFLCLCFISIAAAWPVSKSRQHAISASSEEKYDPRSHHTHRYHQDHVDSQSQEHLQQ
TQNDLASLQQTHYSSEENADVPEQPDFPDIPSKSQEAVDDDDDDDNDSNDTDESDEVVTD
FPTEAPVTPFNRGDNAGRGDSVAYGFRAKAHVVKASKLRKAARKLIEDDATAEVGDSQLA
GLWLPKESREQDSRELAQHQSVENDSRPRFDSPEVDGGDSKASAGVDSRESLASASAVDA
SNQTLESAEDAEDRHSIENNEVTR
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaagctggcatttctttgcttgtgctttatcagcattgctgctgcatggccagtgagc
aaatccaggcagcatgccatttctgccagctctgaagaaaaatacgaccccaggagccac
cacacacacaggtaccaccaggatcacgtggattctcagtctcaggagcacctgcagcag
acacagaatgacctggcttcacttcagcagactcattactcttcagaagaaaatgctgat
gtcccagaacagccggactttcctgacattcctagcaagagccaagaggccgtggatgat
gatgatgatgatgacaatgattccaatgacactgacgagtctgatgaagtcgtcacagac
ttccccacagaggcacccgtgacacctttcaaccgtggggacaacgcaggccggggtgac
agtgtggcatatggcttcagagccaaagcccacgtggtgaaggcgagcaagctccgcaaa
gctgccaggaagctcattgaggatgacgccaccgcggaggttggggacagccagctagcg
ggcctctggttgcccaaggagagccgcgaacaggacagccgtgagctggcccaacatcag
agcgtagagaacgacagccggccaagatttgacagccctgaggtggacggaggagacagc
aaggccagtgctggggtggacagcagagagagcctggctagcgcgtccgccgtcgacgcc
agcaaccagacgctagagagcgctgaggatgccgaagatcgccacagcattgaaaacaac
gaggtcacccgttaa

DBGET integrated database retrieval system