KEGG   Gallus gallus (chicken): 395230
Entry
395230            CDS       T01006                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1 isoform X1
  KO
K04490  transcription factor 7-like 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
gga04520  Adherens junction
gga04916  Melanogenesis
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395230 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    395230 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    395230 (TCF7L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    395230 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395230 (TCF7L1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    395230 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 395230
NCBI-ProteinID: XP_015128732
CGNC: 49223
Position
22
AA seq 551 aa
MPQLEPAAGDDLGAPDELIAFQDEGEEQDKGAGRGSAHGDLDELKSSLVSETEGRAAAPG
GPDAEAERPPQPRESFQKPRDALAEVVRRQQDGGFFKGPPYPGYPFLMLPELGAPYLSNG
ALSPGGARTYLQMKWPLLDVPAGATLKDSRSPSPAHLSNKVPVVQHAPHMHPLTPLITYS
NDHFSPGSPPAHLSPDIDPKTGIPRPPHPPELPPYYPLSPGAVGQIPHPLGWLVPQQGQP
MYSIPPGGFRHPYPALAMNASMSSLMSSRFSPHMVPPPTHGLHPSGIPHPTIVSPIVKQE
SAQPSTSPGVSSKSPITVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQ
ILGRRWHSLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKLAQQQSHEA
ESVLPSRSKKPCAPHHLPPDKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQP
LSLTTKPEARAQLAFLSSKTSSSSSSSSSSSSLGSPPSLLPRPIAFPSLLLSSPPAPQQT
QPLALVTKPAD
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgccgcagctggagccggcggcgggggacgacctgggggctccggacgagctgatcgcc
ttccaggacgagggcgaggagcaggacaagggcgcggggcgcggctcggcccacggggac
ctggacgagctcaagtcctcgctggtcagcgagaccgagggccgcgccgccgccccgggc
ggccccgacgccgaggcggagcggcccccgcagccccgggaaagtttccagaagccgcgg
gacgcgctcgctgaagtggtcagacgacagcaggatgggggtttctttaagggccccccc
taccccggctaccccttcctgatgctccctgagctgggcgccccgtacctctccaatgga
gctctgtcccctggaggtgcccgcacttacctgcagatgaagtggccgctgctggatgtg
ccagccggggccacgctgaaggacagccgctcaccatcacctgcacacctgtccaacaag
gtcccggtggtgcagcacgcgccccacatgcacccattgacgccgctcatcacctacagc
aatgaccacttctcgcccggctcaccgcctgcgcacctctcacccgacatcgaccccaaa
acggggatcccgcgcccgccgcaccctcccgagctgcccccctactacccgctgtcgcca
ggagccgtgggtcagatcccgcacccgctgggctggcttgtgccgcagcaaggacagccc
atgtactccatcccccccggcggctttcggcatccctaccctgccctcgccatgaacgcc
tccatgtccagcctgatgtccagccgcttctccccacacatggtcccgccgcccacccac
gggctgcacccctcgggcatcccacaccccaccatcgtctcacccatcgtgaagcaggag
tcggcccagcccagcaccagccctggcgtcagctcgaaatcccccatcacagtgaagaag
gaggaggagaagaagccccacatcaagaagccgctcaatgccttcatgttgtacatgaag
gagatgagggccaaggtggtggctgagtgcacgctgaaggagagcgcagccatcaaccag
atcctgggccggcggtggcactctctgtcgcgggaggagcaggccaagtactacgagctg
gcacggaaggagcggcagctgcactcacagctctaccccacgtggtcggcccgcgacaac
tacggcaagaaaaagaagaggaagcgagagaagctggcccagcagcagagccacgaggca
gagagcgtgctgccctccaggagcaagaagccgtgcgccccgcaccacctgcctcctgat
aaaccctgcgacagcccggcctcgtcccacggcagcatgctggattcacccgccacgcca
tcggccgccctggcctccccggctgcgcctgccgccacgcactcagagcaggcgcagcct
ctgtcgctcaccaccaagccggaggccagggctcagctcgccttcctctccagcaaaacc
tcctcctcttcctcctcctcctcctcctcctcctccctgggctcccccccgtcgctgctc
cccaggcccatcgccttcccctcgctgctgctctcctctccgcccgccccgcagcagacg
cagccgctcgcgctggtcaccaaaccggccgactga

DBGET integrated database retrieval system