KEGG   Gallus gallus (chicken): 395231
Entry
395231            CDS       T01006                                 

Gene name
HOXA3
Definition
(RefSeq) homeobox protein Hox-A3
  KO
K09303  homeobox protein HoxA/B/D3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395231 (HOXA3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    395231 (HOXA3)
SSDB
Motif
Pfam: DUF4074 Homeodomain
Other DBs
NCBI-GeneID: 395231
NCBI-ProteinID: NP_001336689
CGNC: 49224
Ensembl: ENSGALG00000027925
Position
2
AA seq 413 aa
MQKATYYDSSAIYGAYPYQGANGFTYNASQQQYPPSSSLVETEYHRPACSLQSPGSAVSH
HKANDISESCMRTLPSQPLQPPGLTDPQAPPQPPPAPQAQPPPPSSASPSQNASSNPAPA
NSTKSPALNSPTVSKQIFPWMKESRQNTKQKNSSSSSGESCAGDKSPPGQTSSKRARTAY
TSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMMTS
SGGQSPSRSPVPPAAGGYLNSMHSLVNSVPYEPQSPPPFNKPHQNTYGIPASYTAPLNNC
PPPQKRYTGTAAVTPEYDTHPLQGNGYGNPHIQGSPVYVGGNYVETMTNSGPSIFGLTHL
SHPPSANMDYSGAGPMGNNHHHGPCDPHPTYTDLTAHHPSQGRIQEAPKLTHL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcaaaaagcgacctactacgacagctctgcaatctatggtgcctacccctaccaagga
gcaaatggtttcacttataatgcgagtcagcagcaatatcctccatcttcgtcacttgtg
gaaactgagtaccaccgccccgcgtgctccctccagtcccctggcagcgccgtgtcccac
cacaaggccaatgacatcagtgagagttgcatgaggactctccccagccagcctctgcag
ccccctggcctcaccgacccgcaggccccgccgcagccacctccagccccgcaggcacag
cctccacctccatcctcggcctcaccatctcaaaatgccagcagcaaccctgccccggcc
aactccactaagagcccggctcttaactcgcccaccgtgtccaaacagatattcccgtgg
atgaaagagtctcggcaaaacacaaagcagaaaaacagcagttccagttcaggtgagagc
tgtgctggtgataagagccccccagggcaaacatcctctaagcgagcccgtacggcttac
acaagtgcccagctggtagaactggaaaaggagttccacttcaatagatacctttgcagg
ccacgaagggttgagatggccaatttgctcaatctcacagaaagacagatcaaaatctgg
tttcagaaccgcagaatgaaatacaaaaaggatcaaaagggcaagggcatgatgacctct
tcaggaggacagtccccgagcagaagccccgtccctccagctgctgggggatacctaaac
tctatgcattctttagtaaacagcgtcccctacgagccccagtcgcctccgccatttaat
aagcctcatcaaaacacctatggcatccccgcatcgtataccgctcctcttaataattgc
ccacctcctcaaaagagatacacggggacagcagctgtgacacctgaatacgatactcat
cctcttcaaggcaacggttatgggaatccacatatacagggaagccccgtctacgtaggg
ggcaactacgtggagaccatgaccaattccgggccttccatctttggtctaactcatctc
tctcatcctccctctgccaacatggactacagcggggctgggccgatgggcaacaatcac
caccacggaccttgcgacccgcacccgacatacacagaccttacagctcaccatccttct
cagggaagaattcaggaagcgcccaaactcacccatctgtag

DBGET integrated database retrieval system