KEGG   Gallus gallus (chicken): 395233Help
Entry
395233            CDS       T01006                                 

Gene name
DYRK1A
Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 1A
  KO
K08825  dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     395233 (DYRK1A)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   395233 (DYRK1A)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    395233 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 395233
NCBI-ProteinID: NP_989881
CGNC: 11992
Ensembl: ENSGALG00000016053
UniProt: Q8JG32
Position
1
AA seq 756 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRRQQNINDQQVSASSYT
DRIQQPLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSS
HKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIK
IIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLNRHFMFRNHLCLVFEMLSYNLYDL
LRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDF
GSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVD
QMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGTRKLHNILG
VETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN
TSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQA
MDCETHSPQVRQQFPPPIGWTATEAPTQVTVENHPVQETTFHVTPQQQNALHHHHGNSSH
HHHHHHHHHHHHGQQALGSRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLASSTTSSST
SSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDMNLTVYSNPRQETGIAGHPTYQFSANTG
PAHYMTEGHLAMRQGIDREESPMTGVCVQQSPVASS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgcatactgggggtgagacttcagcatgcaaaccttcatctgttcggcttgcaccatcg
ttttcattccatgctgctggccttcagatggctggacagatgtcccattcacatcagcag
tacagtgatcgtcggcagcagaacataaatgaccaacaggtttctgcctcatcatacact
gaccggattcagcaacctctaacaaaccagaggcggatgccccaaactttccgtgatcca
gctactgctcctttgaggaaactctccgtagatttgattaaaacatacaagcatattaat
gaggtttactatgctaaaaagaaacggcgacatcaacagggccaaggagatgattccagc
cacaaaaaggaacggaaagtttacaatgatggctatgatgatgacaactatgactatatt
gtaaaaaatggggagaagtggatggatcgttatgaaattgactctttaataggcaaagga
tcctttggacaggttgtaaaggcttatgatcgagtggaacaggagtgggtggctatcaaa
ataataaaaaacaagaaagctttcttaaaccaagcccagattgaagtgcgactgcttgag
cttatgaacaaacatgacactgagatgaagtactatatagtgcatttgaaccgccacttc
atgttccgaaaccatctctgcttagtcttcgaaatgctgtcctacaatctgtatgatttg
ttgcggaacaccaacttccgaggggtctctttgaatctgacaagaaaatttgcccagcag
atgtgcactgcactgctttttctggcgactcctgaacttagtatcattcactgtgaccta
aaacctgagaatatcctgctctgtaaccccaaacgaagcgccatcaagattgttgatttt
ggcagttcttgtcaacttgggcagaggatataccaatatatccagagtcgtttctatcga
tcaccagaggtgctactgggaatgccttatgatcttgcaattgatatgtggtcccttggg
tgtattttagttgagatgcacactggagagcctcttttcagtggggcaaatgaggtggat
caaatgaataaaatagtggaagttttggggataccgcctgcccatattcttgaccaagca
ccaaaagcaagaaagttctttgagaagttgccagatggcacttggaacttgaagaagacc
aaagatggaaaaagggaatacaaaccacctggaactcgtaaacttcacaatatactagga
gttgaaacaggaggaccaggtggacgtcgtgctggggaatcgggtcatactgtagctgac
tacttgaagttcaaagacctcatcttaaggatgcttgattatgaccctaagacacgaatt
caaccttattatgccctacagcatagtttctttaagaaaacagcagacgaaggtaccaac
acaagcaacagtgtgtctacgagtcctgccatggagcagtcacagtcttcaggaaccacc
tctagtacatcttcaagctcaggtggatcttctggaacaagcaacagcggaagggcacgg
tcagaccccacgcaccagcatcgacatagtggtggacacttcactgctgctgttcaagct
atggactgtgaaacacacagcccacaggttcgacaacagtttcctcctccgattggttgg
acagccactgaagctcctacacaggtcactgttgaaaaccatccagttcaagaaaccacc
ttccatgtaacccctcaacaacagaatgcattacatcatcatcacggaaatagctctcac
caccaccatcaccaccaccaccaccaccatcatcatggacagcaagccttgggtagccgg
accaggccaagggtctacaattctccaacaaacagctcctccacccaggattctatggag
gtgggccacagtcaccactccatgacatccctggcttcctcaactacttcttcctctaca
tcttcctcctctactggtaaccaaggcaatcaggcctatcagaaccgcccagtggctgct
aataccttggactttggacaaaatggagctatggacatgaatttaacagtctactctaat
ccgcgccaagaaactggcatagctggacatccaacgtaccagttttctgctaatacaggt
cctgctcattacatgactgaaggacaccttgcaatgaggcaagggattgatagagaagag
tctcccatgacaggagtttgtgttcagcaaagtcctgtggctagctcgtga

DBGET integrated database retrieval system