KEGG   Gallus gallus (chicken): 395237
Entry
395237            CDS       T01006                                 
Symbol
SFRP1
Name
(RefSeq) secreted frizzled-related protein 1 precursor
  KO
K02166  secreted frizzled-related protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    395237 (SFRP1)
SSDB
Motif
Pfam: Fz NTR DUF555
Other DBs
NCBI-GeneID: 395237
NCBI-ProteinID: NP_989884
CGNC: 2531
Ensembl: ENSGALG00000003473
UniProt: A0A1L1RQ37
Position
22:complement(2877954..2888842)
AA seq 307 aa
MGRVRGALRALLSLAAGLLACGGASEYDYVSYQSDLGPYPGGRFYTKPHQCVAIPADLRL
CHSVGYDKMVLPNLLDHETMAEVKHQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPVY
PCRWLCEAVRDSCEPVMQFFGFFWPEMLKCDQFPQDDVCIAMTTPNATEVSRPKGTTVCP
PCDNEMKSEAIVEHLCASEFALKMTIKEVKKENGDKVIIPRKRKALKLGPIRKKNLKKLV
LLLKNGADCPCHQLDNLGHHFLIMGRQVKTQHLLTAIYKWDKKNKEFKKFMKKVKAPDCP
TFPSVFK
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggcagagtgcggggcgcgctgcgggcgctgctgtcgctggccgcggggctgctggcg
tgcggcggggccagcgagtacgactacgtgagctaccagtccgacctgggcccctaccct
ggggggcgcttctacaccaaaccccaccagtgcgtggccatccctgccgacctgcggctc
tgtcacagcgtgggctatgataagatggtgttgcccaacctgctggaccacgagaccatg
gccgaggtgaagcaccaggcgagcagctgggtgccgctgctcaacaagaactgccacatg
ggcacccaggtcttcctctgctccctctttgcccccgtctgcctggaccggccggtctac
ccgtgccgctggctctgcgaggctgtgcgtgactcctgtgagcccgtcatgcagttcttt
ggcttcttctggccggagatgctcaagtgtgaccagttcccacaggatgatgtctgcatt
gccatgacaactcccaatgccaccgaagtctccaggcctaaaggaaccactgtgtgtccc
ccatgtgacaacgagatgaagtcggaggccattgttgagcacctgtgtgccagtgagttt
gctcttaagatgaccatcaaggaggtgaaaaaggagaacggggacaaagtgatcattcca
cggaagaggaaggcgctgaagctggggcccatccgcaagaagaacctgaagaagttggtg
ctgctcctgaagaacggggctgactgcccctgccaccagctggacaaccttggccaccac
ttcctcatcatgggccgccaggtgaagacccaacaccttctgacagccatctacaagtgg
gacaagaagaacaaagagttcaagaagttcatgaagaaggtgaaggctccggactgcccc
acgttcccatccgtcttcaagtga

DBGET integrated database retrieval system