KEGG   Gallus gallus (chicken): 395245
Entry
395245            CDS       T01006                                 

Gene name
MSX2
Definition
(RefSeq) homeobox protein MSX-2
  KO
K09341  homeobox protein MSX
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395245 (MSX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Msh
    395245 (MSX2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 395245
NCBI-ProteinID: NP_989890
CGNC: 66198
Ensembl: ENSGALG00000038848
UniProt: P28362
Position
13
AA seq 259 aa
MASPSKAKEVFSSDEEGPAAGAEEHHKVKVSSLPFSVEALMSDKKPPKELPLAAAGGSAD
GATVGTSRNLLLPGHGSRDAHSPPGALTKTFDTASVKSENSEDGTSWIQEAGRYSPPPRH
LSPTACTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKI
WFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPIQAASLYGTSYPFHRPVLP
IPPVGLYATPVGYSMYHLS
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcttctccttccaaagcgaaggaggttttctcctccgacgaggagggcccggcggcc
ggcgccgaggagcaccacaaagtcaaggtgtccagcttgccgttcagcgtggaagccctc
atgtccgacaagaaaccccctaaagagctgccgctggccgcggcggggggcagcgccgac
ggggcgaccgtgggcacctccaggaacctgctgctgccgggccacggctcccgggacgcg
cacagcccccccggggctcttacaaaaaccttcgacaccgcttcggtcaaatcggagaac
tcggaggacggcacgtcctggatccaagaggccgggagatattcgcctcctccaagacac
ctgagccctacagcctgcactctgaggaagcacaagacgaatcggaagccccgcacccca
ttcactacttcccagctgctggccctggagcgcaagttccgccagaagcagtacctgtcc
atcgccgagcgagccgaattctccagctccctcaacctcacagagacccaggtcaaaatc
tggttccaaaatcggagggccaaggccaagagactgcaggaggctgagctagagaagctc
aaaatggcagcgaagccaatgttgccgtcggggttcagcctccctttccccatcaactcc
cccatccaggccgcctcactgtacggaacatcctacccttttcacagacctgtgcttcct
atcccgcccgttggactctatgctactcctgtcggatatagcatgtaccacttatcttaa

DBGET integrated database retrieval system