KEGG   Gallus gallus (chicken): 395247
Entry
395247            CDS       T01006                                 

Gene name
SMAD2Z
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
gga04144  Endocytosis
gga04218  Cellular senescence
gga04350  TGF-beta signaling pathway
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395247 (SMAD2Z)
   04371 Apelin signaling pathway
    395247 (SMAD2Z)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    395247 (SMAD2Z)
  09143 Cell growth and death
   04110 Cell cycle
    395247 (SMAD2Z)
   04218 Cellular senescence
    395247 (SMAD2Z)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 395247
NCBI-ProteinID: NP_989892
CGNC: 49229
Ensembl: ENSGALG00000036001
UniProt: Q8UWF3
Position
Z
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSAGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPSTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcatccattctgccattcactccaccggttgtgaagagactccttgggtggaagaag
tcagctggtggctctgcaggggctggtggtggtgagcagaatgggcaagaggagaagtgg
tgtgaaaaagcggttaaaagcttggtcaagaagctaaagaaaacaggacagctggatgag
cttgagaaggccattaccactcagaactgcaatacgaagtgtgtgactataccaagcact
tgctctgaaatttggggactgagtacaccaaacacgatagatcagtgggacacaacaggc
ctttacagcttctctgaacaaaccagatctctcgatggccgactacaggtgtcgcatcgt
aaaggactaccgcatgtcatctactgtcgcctgtggcgctggccggatcttcacagccac
catgaacttaaagcaattgaaaactgtgaatatgcttttaatcttaaaaaggatgaagtg
tgtgtgaatccataccactaccagagagtggagacaccagtcttgcctcctgtactagtg
ccacggcacactgagatcctaactgagcttcctcctctcgatgactacactcattccatt
cctgagaacactaatttcccagctgggattgaaccacaaagcaattacataccagaaaca
ccacctccaggatatatcagtgaagatggagaaacgagtgaccagcagttgaaccaaagc
atggatacaggatctccagcagagctgtctcccagcactctctctccagttaaccatagc
ctggatttgcagccagtcacttactcggagcccgcattctggtgttctatagcgtattac
gaattgaatcaaagagtgggagaaaccttccatgcatcacaaccttccctgactgtggat
ggcttcacagacccatccaattcggaacggttttgtctaggtctgctttccaacgtcaac
aggaatgcaacagtggaaatgacaagacgacacatagggaggggagtgcgtctctattac
atcggcggagaagtgtttgccgagtgcctcagtgatagcgcgatttttgttcagagcccc
aactgtaatcaaagatatggctggcatcctgcaaccgtctgcaaaatcccaccaggatgc
aatctaaaaatctttaataaccaagagtttgctgctcttctggctcagtctgtgaatcag
ggttttgaagcagtttatcagcttaccagaatgtgtaccatcaggatgagttttgttaaa
ggatggggagctgagtataggcggcagaccgtaacaagcactccttgctggattgaactt
catctgaacggacctctacaatggctggacaaagtattgactcagatgggctccccttca
gtacgctgctccagcatgtcgtaa

DBGET integrated database retrieval system