KEGG   Gallus gallus (chicken): 395271
Entry
395271            CDS       T01006                                 

Gene name
DMBX1
Definition
(RefSeq) diencephalon/mesencephalon homeobox protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 395271
NCBI-ProteinID: XP_001234036
CGNC: 7944
Ensembl: ENSGALG00000010436
Position
8
AA seq 419 aa
MLPPGRWQLRRARRQRGGNADGWSRAGRGAAPRPFPTRVPAPTAGGEASPPPQVDVAMQH
YGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLADIILEARYGSQH
RKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRK
KQRSLQKEQLQKQKDCESSHSEGKTEPPVLETQSTIPDTEKTQSIPSEVSTDLNLTLSEQ
SASESAPEDQTDREEEFKSTLDEAKVDKSPGVDGKALNCKRASPKSESPISATVTPSSSS
GLAQTHSYSSSPLSLFRLQEQFRQHMAATNNLVHYSSFEMGTPSAMPYLGMNVNMAPLSS
LHCQSYYQSLSHAQQVWSSPILQASSSLPSLNSKTTSIENLRLRAKQHAASLGLDTLPN
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgctgcctcccggtagatggcagctccgccgggcgcggaggcagcgcggaggcaacgcg
gacggatggagtagggcgggccggggcgccgcgccgcgcccgttccccacgcgtgtcccc
gctcccaccgcgggcggagaggcttcgccgccgccccaggttgatgtcgccatgcagcac
tatggggtgaacggatactccctgcatgccatgaactcactgagcgccatgtacaacctg
caccagcaggcagcccagcaagcacagcacgcgcccgactaccggccctcagtgcacgcc
ctcaccctggcggagagactggctgacatcattttggaggcacgttatggatcccagcac
cgcaaacaaaggcgaagtcgcacggccttcactgcccaacagctggaggcactggagaag
accttccagaagacacactatccagatgtagtgatgagagagcggctggctatgtgcaca
aatctgcctgaagccagagtccaggtttggttcaagaaccgaagggccaaattccggaag
aagcagcgtagcctccagaaggagcagctgcagaagcagaaggactgtgaaagcagccac
agtgaggggaagacggaaccacctgtgctggagacccagtccacaatacctgacactgag
aagactcagagcatcccaagtgaggtgagcacagacctcaacctaaccctgtcggagcag
tcagccagtgaatcagcgcctgaggaccagactgacagagaggaggagtttaagagcacc
ttggatgaggctaaagtggacaagagtcctggtgtggacggcaaggctttgaactgcaag
agagcgagcccaaaatcagagtctcccatcagcgcgaccgtgactccttcatctagcagt
ggcctggctcaaactcactcctactcctcctcacccctgagcctcttccgcctgcaggag
caattccgccagcacatggcagctaccaacaacttggtccattactcctccttcgaaatg
gggacaccgtctgccatgccctacttgggcatgaatgtcaacatggcgcctctgagctcc
ctgcactgtcagtcgtactaccaatctctctcccacgctcagcaggtctggtcctcaccc
atcctgcaggcctccagctctcttccaagcctgaacagtaaaacaacaagtattgagaac
ctaaggctccgggcaaagcagcatgcagcatcccttgggcttgacaccctacccaactga

DBGET integrated database retrieval system