KEGG   Gallus gallus (chicken): 395281
Entry
395281            CDS       T01006                                 

Gene name
ID3
Definition
(RefSeq) DNA-binding protein inhibitor ID-3
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    395281 (ID3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395281 (ID3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    395281 (ID3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 395281
NCBI-ProteinID: NP_989920
CGNC: 49242
Ensembl: ENSGALG00000035317
UniProt: Q90X14
Position
23
AA seq 125 aa
MKAISPVRSVRSCYEAVCCLSEQSLAIARSSNNKSPALEEPMNLLYDMNDCYSKLRELVP
GIPQGTKLSQVEILQHVIDYIFDLQIVLEEGAKGRDPSSEATLLSLKAAELASGLCSKDE
RSLCH
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaagccatcagcccggtgcggtcggtcaggagctgttacgaggccgtttgctgcctc
tcggagcagagtttggccatcgcccgcagcagcaacaacaagagcccggcgctggaggaa
cccatgaatctgttgtacgatatgaacgactgctactccaaattgcgggagttggtgccg
ggcatcccgcagggcaccaagctgagccaggtggagatcctccagcacgtcatcgattat
atcttcgacctgcagatcgtgctggaagagggggccaaggggcgagacccctcctcggag
gccaccctgctgtcccttaaggcggctgagttggcctccgggctgtgctccaaagacgag
agaagtttgtgtcactaa

DBGET integrated database retrieval system