KEGG   Gallus gallus (chicken): 395291
Entry
395291            CDS       T01006                                 

Gene name
ROBO2
Definition
(RefSeq) roundabout homolog 2 isoform X1
  KO
K06754  roundabout, axon guidance receptor 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395291 (ROBO2)
   04515 Cell adhesion molecules [BR:gga04515]
    395291 (ROBO2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   395291 (ROBO2)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  ROBO family
   395291 (ROBO2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set Ig_6 C2-set_2 Ig_5 Ig_4 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 395291
NCBI-ProteinID: XP_015154014
CGNC: 49245
Ensembl: ENSGALG00000015519
Position
1
AA seq 1603 aa
MLSSVRRGKITMLELLFILMLLFSGPTLSKLSRTKGKHWKGGSRLRQEDFPPRIVEHPSD
VIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGR
RSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRG
HPEPTIYWKKDKVRIDDREERISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAEL
TVFERPTFLRRPINQVVLEEEAVDFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLR
IKKAMSTDEGTYTCIAENRVGKVEASATLTVRARPVAPPQFVVRPRDQIVAQGRTVTFPC
ETKGNPQPAVFWQKEGSQNLLFPNQPLQPNSRYSVSPTGDLTITNIQRSDAGYYICQALT
VAGSILAKAQLEVTDVLTDRPPPIILQGPVNQTLAVDGTALLKCKATGDPLPVISWLKEG
FTFLGRDPRTSIQDQGTLQIKTLRLSDTGTYTCVATSSSGETSWSAVLDVTELGGATVSK
NYDINDLPGPPSKPQVTDVTKNSVTLSWQPGTPGSLPASAYIIEAFSQSVSNSWQTVANH
VKTTLYTVRGLRPNTIYLFMVRAINSQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKEL
GDVIVRLHNPVVLTPTTVQVTWTVDRQSQFIQGYRVMYRQTSGLPSPAVWQNLEVKVPTE
RSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKSARTTEEAPSAPPQSVTVLTVGNHNST
SISISWDPPPPDHQNGIIQEYKIWCLGNETRFHINKTVDAAIRSVVIGGLYPGIQYRVEV
AASTSAGVGVKSEPQPIIIGGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILM
GFSIWLYWRRKKRKGLSNYAVQSFTFTPAVTFQRGDGGLMSNGSRPGLLNASDPSYPWLA
DSWPATSLPVNNSSSGPNDLANFSRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSY
NSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKNDLMGFGYSLPDQGKGNN
ALLYIPDYRVAEGLANRLPHNQSQDFSTTSSHNSSERSGSLSGGKGGKKKKSKNTAKPQK
SNGSNWASVPLPPPPVQPLPGTELEHYGVDQQEAGYDSDGWCPPLPVQTYLHQGMEDELE
EDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQ
TWHIQSNTQPPQAPVPPLGYVSGNLISDLETDVPDDDEDDIEEETLEINRPLRGLEHTPG
SSMDNLDSSVTGSMVNGWGSASDEDRNFSSHRSSVGSSSDDSIFTSGSFAQALVAAADKA
GFRLDGTSLTRTGKAYPSSQRPRPSSPFSTDSNTSAAVTQSQRPRPTKKHKGGRLDQPPL
PHRREGITDDLPPPPDPPPGQGLRQQIGSGQRGGSAERKGSSLERQHAPSVDDTKSSLDR
QARTSLEWQRQTQEWISSAERQEDFRKAQHKQAFGSEEALVPYSKPNFPSPGGHSSSGTA
SSKGSTGPRKGEVFRGGHQRNASDLLDVGYLGSNSQGQFTGEL
NT seq 4812 nt   +upstreamnt  +downstreamnt
atgttatcatcagtgagacgggggaaaatcactatgcttgaacttcttttcattttgatg
ttgctcttctctggaccaaccctgagcaagcttagcaggaccaaaggcaaacactggaag
gggggatcccgtctccgccaggaggactttccaccgcggattgttgagcatccttcagat
gtgatagtctctaaaggagaaccaacaaccctgaactgtaaagctgaaggacggccaact
cctactattgaatggtacaaagatggagagcgagtggaaactgacaaagatgatcctcgc
tcccaccgtatgctgctgcctagcggatctttatttttcttacgtattgtgcatggacgc
aggagtaaacctgacgaaggaagttatgtttgcgtagcaaggaactatcttggagaagct
gtgagtcgcaatgcatctctggaagtggcattgctacgagatgacttccgccaaaaccct
acagatgttgtagtggcagctggagaacctgcaatactggagtgtcagccacctcgtgga
caccctgagcctaccatctactggaaaaaagataaagtccgtattgatgacagggaagag
cggatcagtatacgtggtgggaagctaatgatctccaacacacgaaaaagtgatgctggc
atgtacacttgcgttggaaccaacatggtgggggaacgagacagtgatccagcagagctg
actgtctttgagcggcccacgtttctcaggagaccaatcaaccaggtggtgctggaggag
gaggccgtggatttccggtgccaggtgcagggggacccgcagccgaccgtccgctggaag
aaggatgacgcagacctgccaagaggaaggtatgacattaaagatgactacactttgcgc
atcaagaaggctatgagcacagatgaaggcacctacacgtgcattgctgagaatcgagtt
ggaaaagtggaagcatctgctacccttactgtgcgagctcgccccgttgctcccccacag
tttgtggtgagaccacgagatcagattgtagcccagggtcgaactgtgacttttccttgt
gaaactaaaggaaatccccagccagctgttttttggcaaaaagaaggaagccagaatctg
ctcttcccaaaccagcctctccaacccaacagtagatactcagtatcaccaactggagac
ctcactattaccaacattcaacggtctgatgcaggctactacatttgtcaagcactgacg
gttgctggaagcattttagcaaaggctcagctggaggttactgatgtcttgacagataga
cctccacccatcatcctccaggggcctgtcaatcagacgctggcagtggacggaacagct
ctgctgaagtgcaaggctactggtgacccacttcctgttatcagctggttaaaagaaggc
ttcacttttctgggcagagaccctcgaacatccatacaggatcaggggacccttcagatt
aaaactctgcggctgtctgatactggaacttacacttgtgttgcaacaagttcaagtggg
gagacatcatggagtgctgttctggatgtgacagagttgggtggagcaacagtcagtaaa
aattatgacataaatgacctccctggaccaccatccaaacctcaggtcactgatgttact
aagaacagtgtcaccctgtcctggcaaccagggacccctggaagcctaccagctagtgca
tatatcattgaggcttttagtcaatctgtgagcaatagttggcaaacagtggctaaccat
gtgaagaccactctctacactgtgagaggactgcgtcccaataccatctatctgtttatg
gtgagagctatcaattcacaaggtctgagtgatcccagccctatgtcagatcctgttcga
acacaagatatcagtccaccagcacaaggtgtggatcacaggcaagtccagaaggaactg
ggagacgtcattgtacgactgcataaccctgttgtgctgacacccacaacagttcaagtt
acctggacagttgaccgtcaatcgcagtttattcagggctaccgagtaatgtatcgccaa
acgtctggcctaccgtctccagctgtatggcagaatttggaggtcaaagtcccaacagag
cgcagtgctgttctagtcaacttgaaaaaaggagtcacttatgaaattaaagttcgcccg
tacttcaatgaatttcaaggaatggacagtgaatcaaagtctgctcgtaccacagaggaa
gctccaagtgcccctcctcagtctgttactgtcctgacagttggaaatcacaacagcaca
agcatcagcatctcctgggatcctccccctccagatcaccaaaatggaatcatccaggag
tacaagatctggtgtctaggtaatgagactcgatttcatatcaacaaaacagtagatgca
gccattcggtctgtagtaataggtggcctgtatccaggtattcagtaccgtgtagaagtt
gctgccagcaccagtgcaggtgtgggagtgaaaagtgagccacaacccataataattgga
ggccgtaacgaagttgtcatcactgaaaataacaacagcataactgagcaaatcactgat
gttgtcaaacagcctgcctttatagctggcatcggtggtgcatgttgggtaattctgatg
ggtttcagcatctggctgtactggcgcagaaagaagaggaaggggctcagtaattatgct
gttcagtccttcaccttcacccctgcagtcacattccaaagaggagatggaggactaatg
agcaatggaagtcgaccaggtttgttgaatgcaagtgaccccagttatccttggcttgca
gactcttggcctgccacaagtctgccagttaacaacagctctagtggacccaatgacctt
gccaatttcagtcgtggagatgtgttgccaccagtgccaggacaaggagataaaactgct
actatgctttctgatggagccatttacagcagcattgacttcacgacaaaaactagttac
aacagttccagccaaataacgcaagctacaccatatgccaccacccagatactgcattcc
aacagcatccatgagttggcagtcgacttacctgatcctcagtggaaaagctcaattcag
caaaaaaatgacctgatgggatttggctactctctcccagaccaaggcaaaggcaacaat
gccttgctttacatccctgactaccgcgtggctgagggattggctaatagattgccacac
aaccagtcacaggatttcagcaccaccagctcccacaacagctccgaaaggagtggcagc
ctctcaggtggcaaaggagggaaaaagaagaaaagcaaaaatactgccaagcctcagaaa
agtaatggttcaaactgggccagtgttcccctcccaccccctcctgtgcagccgcttcca
ggcacagagctggaacactacggggtggatcaacaagaagcaggatatgacagtgatggt
tggtgtccacccttgcctgttcagacctacctccatcagggcatggaggatgagcttgaa
gaagatgatgatcgtgttcccacacctcctgtgcgaggagtagcttcatcacctgcgatc
tcctttgggcaacaatcaactgcaaccctcacgccttctccgcgagaggagatgcagcca
atgcttcaagcccacctcgatgaattaaccagggcctaccagtttgatatagcaaagcag
acatggcacatccaaagcaatacacaacctcctcaggctccagttccacccctaggatat
gtatctggaaaccttatttcagacttggaaacagacgttccagatgatgatgaggatgat
attgaagaagaaactctagaaatcaataggccactgagaggtctagagcatactccaggc
tccagtatggacaatctagacagctctgtgacaggttcaatggtaaatggatggggttct
gcgtctgatgaggaccgtaacttttctagtcatagatctagtgtaggtagctcctcagat
gactcgatctttaccagcggcagttttgcacaagcactggttgcagcagcagataaagct
ggttttaggctggatggaaccagcctgacaagaacaggcaaagcatatccttcctctcag
agacctcggccaagcagtcctttttctactgacagcaacaccagtgcagctgtcactcag
agtcagaggccaaggcccactaaaaaacacaagggaggccggttggaccaaccccccttg
cctcatcgtagggaaggaataacagacgatcttccaccaccacctgacccaccgcctggt
cagggtttaaggcagcaaataggctcgggccagcgcggaggctcggcagagaggaaagga
agctctcttgagaggcagcatgcacccagcgtagatgacacaaagagctccttggaccgg
caagctaggacgtcactagagtggcagcggcaaacccaagagtggataagctctgcagaa
cgccaagaggatttcaggaaagcccaacacaagcaagcattcggatcagaagaggcactg
gtaccatacagtaaacccaacttcccatcccctggtggccacagctcttcaggaacagct
tcttctaaaggatcgactggacctagaaaaggtgaagtctttcgaggaggtcaccaacgc
aatgccagtgaccttcttgatgtaggctatttgggatcaaacagtcaaggacagtttact
ggtgaattatag

DBGET integrated database retrieval system