KEGG   Gallus gallus (chicken): 395301Help
Entry
395301            CDS       T01006                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    395301 (KCNMB1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   395301 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB
Motif
Other DBs
NCBI-GeneID: 395301
NCBI-ProteinID: NP_989933
CGNC: 1510
Ensembl: ENSGALG00000002118
UniProt: O93393
Position
13
AA seq 200 aa AA seqDB search
MLAKKLVTAQKRGETRALCLGLGMVACSMMMYFFIGITIVPFYTKSVWTTETICKVLKVN
IKDKALCSNSEGSEDEDIFHYPCLHVWVNLTASGQEVMLYYTEDTLERNPKCSYVPGNSE
NAKEVKAKIEEIANNFKKYQTFPCYYDPGGMQTNVILSRLYPPRGLLFTFLWPTLMFTGG
CLIIVLVKISQYVSVLSARQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaaaaaagctggtgactgcacagaagcgaggagagacgagggccctctgtctg
ggactgggaatggtcgcatgctccatgatgatgtacttcttcattgggattacaattgtg
ccattctacaccaaaagtgtttggacaacagaaaccatatgcaaggtcctcaaagtcaac
atcaaggacaaagccctgtgctcaaacagcgaaggctcagaagatgaagatatctttcac
tacccttgcctacacgtgtgggttaatctgacggcctcaggacaagaggtcatgttgtat
tacactgaagataccctggaaagaaatccaaagtgctcgtatgtccccggcaactccgag
aacgccaaagaagtgaaagcaaaaatagaagaaattgcaaacaatttcaagaagtatcag
accttcccgtgctactatgacccaggaggaatgcagaccaatgtcattttaagcagactt
tacccccccagaggcctcctcttcactttcctttggcccacgctcatgtttactggtgga
tgtctgattatcgtcctggtaaagatcagtcagtatgtttctgttctttctgctcggcag
tag

DBGET integrated database retrieval system