KEGG   Gallus gallus (chicken): 395304
Entry
395304            CDS       T01006                                 

Gene name
SREBF2
Definition
(RefSeq) sterol regulatory element-binding protein 2
  KO
K09107  sterol regulatory element-binding transcription factor 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395304 (SREBF2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    395304 (SREBF2)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 395304
NCBI-ProteinID: XP_015144523
CGNC: 49254
Ensembl: ENSGALG00000041687
UniProt: A0A1D5PX69
Position
1
AA seq 1112 aa
MESGELGTEGMETLTELGDELTLGDIDEMLQFVSNQAGDFPDLFSDPLCGTFQGGGGGGG
SGTGVGALDAARPYGQAPQPFPPPAASPQLQSVPVKAPPAPQRPAPLLQPRPQLQPQLQQ
QTVMIAPTFSSAPQTRIIQQPVLYQNAATSFQVLQPQVQSLVTSPQVQPVTIQQQVQAVP
APRVLTQAAGGTIQALAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDGNPVMA
AVQNPALTALTTPIQTTALQTLVGSNGTILTTMPVMMGQEKVPIKQVPGGVKQPDPPKEG
ERRTTHNIIEKRYRSSINDKIIELKDLIMGTDAKMHKSGVLRKAIDYIKYLQQANHKLRQ
ENMVLKLANQKNKLLKGIDLSSLVDNDADLKIDDFNQNVLLMSPPASDSGSQAGFSPYSI
DSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCALTFLCLSFNPLTSLLDARGSPES
DSLTRHGSGRNMLTIESDTGGWFGWMMPTLILWLVNGVIVLSVFVKLLVHGEPVTRLHSR
SSVTFWRHRKQADLDLARGDFAAAASNLQTCLSVLGRALPASRLDLACSLSWNVIRYSLQ
KLALVRWLLKRTSHQWRAREATAGSEDEAKTSARDAALAYHKLHQLHITGKLPSSSAYSG
LHMALCAVNLAECAEEKIPPSTMAEIHLTAAVGLKTRCGGKLGFLASYFLSQAQSLCSSE
RSAIPDSLRWLCHPLGQKFFVERSWTVKSAAKESLYCTQRNPADPIAQVHQAFCENLLER
AVDSLVKPQTRKEVVGQEEDEPCEFSSAMEYLKLLNSFLDSMGSGAPPFASSSMLKSALG
PDVVCRWWSAAVAMAIGWLRGDDTAVRSRFSIVERLPKSLEMSENALVKATFHLCKAMQA
SLSSKADGQQSSLSHCERASSHLWNSLNMSSGASSTPLSNVIQLLACDLLLSLRTSLWQK
QASSSQALGETYHASPPELTGFQRDLGSLRKLAHGFRPAYRKVFLHEATVRLMAGASPTR
THQLLEHSLRRRTTQNSKQGELDTLPGQRERATAILLACRHLPLSFLSSPSQRAVLLAEA
ARTLEKVGDKRSCNDCQQMIVKLSGGTAIAAS
NT seq 3339 nt   +upstreamnt  +downstreamnt
atggagagcggcgagctgggcaccgagggcatggagaccctgaccgagctgggcgacgag
ctgacgctgggcgacatagacgagatgttgcagttcgtcagcaaccaggcaggggacttc
ccggacctgttttcggaccctctgtgcggcaccttccagggtggcggtggcggtggtggc
agtggcacgggcgtcggggccctggatgccgcgcggccctatggccaggccccgcagccc
ttccctccgcccgccgcctctccacagctgcagagcgtcccggtgaaggcgcccccggcc
ccgcagcgcccggccccgctgctccagccccggccccagctccagccacagctccagcag
cagacggtgatgatcgcccccaccttcagctctgcgccccagaccaggatcatccagcag
cccgtcctgtaccagaacgcggccacgagcttccaagttctccagcctcaggtgcagagc
ctggtgacgtccccccaggtgcagccggtcaccatccagcagcaggtgcaggcggtgccg
gccccacgtgtgctgacgcaggctgccggtggcaccatccaggcactggcacccgccacg
gtccagacggtggcagcaccgcaggtccagcaggtgccggttctggtccagcctcagatc
atcaagacggactccctcgtgctgaccacgctgaagacggacggcaatcctgtcatggct
gcagtgcagaacccagcgctcaccgcgctcaccactcccatccagaccacagcactgcag
acccttgttgggagcaatggaaccattctgaccacaatgccagtgatgatggggcaagaa
aaggtgcctatcaaacaagttcctggaggtgtcaagcaaccagacccacctaaggaagga
gaaaggagaacaactcacaacatcattgaaaagcgttaccgatcctctataaatgacaag
atcattgagctgaaggacctcatcatggggacagacgccaagatgcacaagtctggagtc
ctgagaaaagccattgattacatcaaatacctgcagcaggccaaccataagctgagacag
gagaacatggttctgaagctggctaaccagaaaaacaaactgttgaagggcattgaccta
agcagtctggttgacaacgatgcggacctgaagatagatgacttcaaccagaatgttctt
ctgatgtctcctcccgcctctgattcgggatcacaggctggcttctccccctattccatt
gattcagagccaggaagcccactccttgatgatgcaaaggttaaggatgaacctgactct
cctcctgtggctcttggcatggtggaccgctcccgaatcctcctgtgtgccctgacattc
ctgtgcctctccttcaaccctttgacatcccttctggatgcccgagggagtccggagtcc
gacagcctcacgcgccacggctctggcaggaacatgctgaccattgagtccgacacaggt
ggatggtttggctggatgatgcccacgctgatcctgtggctcgtgaatggtgtgatcgtc
ctcagcgtgtttgtgaagctcctcgtgcacggagagccagtgacccggctgcactcgagg
tcgtcggtcacgttctggaggcaccgcaagcaggcagacctggacctggcacggggggat
tttgctgcggcagcatcaaacctgcagacctgcctgtcggtcctgggccgagcactgccg
gcctcccgcctggacctggcctgcagcctctcctggaacgtcatccgctacagcctgcag
aagctagcgctggtgcggtggctgctgaagaggacctctcaccagtggagggccagagag
gccactgcgggctctgaggacgaggccaagaccagcgctcgggacgcagctctggcctac
cacaagctccatcagctccacatcacaggtaaactcccctccagctccgcttactccggt
ttgcacatggccctgtgtgccgtcaatctggccgagtgtgccgaagagaagatcccgccc
agcacaatggctgaaatccacctgacggctgcagttggcctgaagacccgctgcggaggc
aagctgggcttcctggcgagctatttcctaagccaggcgcagagcctgtgcagctcggag
cgcagcgccatccccgactcgctgcgttggctgtgccaccctctgggacagaagttcttt
gtggagcgaagctggacggtgaagtctgctgccaaggagagcctgtactgcacccagagg
aaccccgcggatcccatagcacaagttcatcaggcgttctgtgagaacctgctggagaga
gcagtggattcccttgtgaagcctcagaccaggaaagaggtggtgggacaagaggaggac
gaaccgtgcgagttctccagcgcgatggaatacctgaaattgctcaactctttcctggac
tcaatgggaagtggagcaccgccctttgccagcagttctatgctgaaatcagccctgggc
ccggatgtggtgtgcaggtggtggtcggcagcagtcgctatggccatcggttggctcaga
ggggatgacacagctgtgaggtcacgtttcagcatagtggagcgcctgccgaagtccctg
gagatgtctgagaatgccctggtgaaagccaccttccacctgtgcaaagccatgcaggcg
tcgctgtcatcgaaggcggatgggcagcagagctcactgagtcactgcgagagggccagc
agccacctgtggaacagcctcaacatgagcagcggtgcctccagcactcccctcagcaac
gtgatccagctgctggcctgtgacttgctgctgtccctccgcaccagcctgtggcagaag
caggcgagcagcagccaggcgctgggtgagacctaccatgcctcaccccccgagctcact
ggcttccagcgtgacctcggcagcctgcgcaagctggcccacggcttcaggcccgcgtac
cgcaaggtcttccttcacgaggccaccgtgcgcctgatggcgggggccagccctacccgc
acccaccagctgctggagcacagtctcaggcgtcgcacaacccagaacagcaagcaaggg
gagctggacacgctgccagggcagagggagcgagccactgccatcctgctggcctgccgc
cacctcccactctctttcctgtcctcgcccagccagcgtgccgtcctgctggctgaggct
gcacgcacgctggagaaggtgggggacaagcgctcgtgcaacgactgccaacagatgatt
gtcaagctgagtgggggcacagccatcgccgcctcctaa

DBGET integrated database retrieval system