KEGG   Gallus gallus (chicken): 395316
Entry
395316            CDS       T01006                                 

Gene name
CENPH
Definition
(RefSeq) centromere protein H
  KO
K11500  centromere protein H
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    395316 (CENPH)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     395316 (CENPH)
SSDB
Motif
Pfam: CENP-H SesA
Other DBs
NCBI-GeneID: 395316
NCBI-ProteinID: NP_989942
CGNC: 10967
Ensembl: ENSGALG00000014788
UniProt: Q90ZF9
Position
Z
AA seq 235 aa
MAGRLSESVGSGPGAEAETAADPDAKRDVLEHLCARTHLKQLVMEFDTACPPDEGCNSGA
EVNFIESAKETLEEVGKVKSAFESKALVIKRIQLMDALRKRVKENDGCARLIVETMRDII
KLNWEIIQAHQQARVIRENLNDIRRKRYFLKQAEGEKALRIFTTVRKKKEVVRMKIAEKL
KFIHRNVQYERKVTTLVQNILQNIIVGCQINWAKDPSLRAIILQLEKDISIQNLL
NT seq 708 nt   +upstreamnt  +downstreamnt
atggcggggcggctgtcggagtccgtcgggtccgggccgggcgctgaggccgagacggcg
gccgatccggacgcgaagcgggacgtcctggagcacctctgcgcgaggacgcatctgaag
cagctggtgatggagttcgacaccgcgtgcccccccgatgaagggtgcaacagtggcgcg
gaagtaaactttatcgaaagtgccaaagaaactttggaagaagtggggaaagtaaaaagt
gcctttgaaagcaaagcattagtcataaaaaggatccagcttatggatgctctgagaaag
agagtgaaagaaaatgatggttgcgcacgactgatcgtggaaacaatgagagacataatc
aagctcaactgggaaataattcaagctcatcagcaagcacgtgtgattagagagaatttg
aatgacattagaaggaaaagatactttctgaaacaggccgaaggagagaaggcgctgcga
atttttaccacagtgaggaaaaaaaaggaagtagtcagaatgaaaattgctgaaaagttg
aagtttatccataggaatgtacagtatgaaaggaaggtgactacgttagttcaaaatata
ctccagaatatcatagtcggatgccaaatcaactgggcgaaagatccatctttaagagca
attattctacagctcgagaaagatatctccattcagaatctcttgtag

DBGET integrated database retrieval system