KEGG   Gallus gallus (chicken): 395320Help
Entry
395320            CDS       T01006                                 

Gene name
CDX4
Definition
(RefSeq) homeobox protein CHOX-CAD2
  KO
K09312  homeobox protein CDX1/4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395320 (CDX4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cad
    395320 (CDX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 395320
NCBI-ProteinID: NP_989945
CGNC: 49264
Ensembl: ENSGALG00000007657
UniProt: Q90Z54
Position
4
AA seq 263 aa AA seqDB search
MYVSSLLDKETSMYPGPARCSNNNLPVQNFVPAPPYSDYMGYHHVPAPDSHGQPAGAWGP
HYGPQREDWNAYGPCPGPSGTAAAAQLSGSSPGQGSYSPAEYSSLHPAAPGGLPPAGTVG
TQQVSPTNQRHSSYEWMRKTVPTNTTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIR
RKSELAANLGLSERQVKIWFQNRRAKERKIIKKKISQFDGSGGSVQSDSGSLSPNEITSS
LFPPPHGINVLQSADIHQVIVSE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgagttctctcttggataaagagaccagcatgtatccaggacctgcaaggtgc
agcaacaacaacctgccagtgcagaactttgtgcctgctcccccctactcagactacatg
gggtatcaccacgtgccagctccagacagccacggacagcccgcgggagcctggggaccc
cactacggcccccagagggaggactggaacgcttacggcccgtgcccagggccctccggc
acggctgctgccgcacagctcagcggctcctctcctgggcagggctcctacagtccagct
gagtacagctccctccatcccgctgcacccggggggttacctcctgcaggcaccgttggc
acacagcaggtctcacccaccaaccaaaggcacagctcttacgaatggatgaggaaaacg
gtgccaactaacactactggtaaaacaagaacaaaagagaagtaccgggttgtttacaca
gaccatcagagactagaattagagaaggaatttcactgcaacagatacattacaataagg
agaaagtcagaacttgcagcaaaccttggactatctgaaagacaggtaaaaatctggttc
cagaatcgccgagccaaagaaagaaaaataatcaagaagaaaatctctcagtttgatggc
agcgggggctcagttcagagtgactctggttcactcagccctaatgaaataacaagttcc
ctgttcccaccaccacacggaataaatgtattacagtctgctgacatccatcaggtcata
gtttcagaatga

DBGET integrated database retrieval system