KEGG   Gallus gallus (chicken): 395322Help
Entry
395322            CDS       T01006                                 

Gene name
NKX2-1
Definition
(RefSeq) homeobox protein Nkx-2.1
  KO
K09342  homeobox protein Nkx-2.1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395322 (NKX2-1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    395322 (NKX2-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 395322
NCBI-ProteinID: NP_989947
CGNC: 49266
Ensembl: ENSGALG00000037632
UniProt: Q9YH59
Position
5
AA seq 344 aa AA seqDB search
MSMSPKHTTPFSVSDILSPWEESYKKVGMEGSNLGAPLSAYRQSQVSQPAMQQHPMGHNG
TVTAAYHMTAAGVPQLSHATMGGYCNGNLGNMSELPPYQDTMRNSASATGWYGTNPDPRF
SSISRFMAPSSGMNMGGMGGLSSLGDVSKSMAPLQSTPRRKRRVLFSQAQVYELERRFKQ
QKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAHEMQQENGSCQQQQSPR
RVAVPVLVKDGKPCQAGSNTPTAAIQSHPQQAATTITVATNGNSLGQHQSHQTNSAGQSP
DMGQHSASPSSLQSQVSSLSHLNSSTSDYGTAMSCSTLLYGRTW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgagcccaaagcatacgactcctttctcagtgtcggacatcttgagtccttgg
gaggaaagctacaagaaagtgggcatggagggcagtaacttgggggctcccttgtcagcc
tacagacagtctcaggtttcgcaaccggccatgcagcaacaccccatgggccacaacgga
acggtgactgccgcctaccatatgacagcggcaggggtcccccagctctcccacgctacg
atggggggctactgcaatgggaacctgggcaacatgagcgagctcccgccttaccaggac
accatgcggaacagcgcttcggcgacaggatggtacggcaccaacccggacccccgcttc
tcctcaatctcccgcttcatggcgccgtcctcgggcatgaacatgggcggcatgggcggc
ctgagctccctgggggacgtgagcaagagcatggccccgctgcagagcacgccgcggagg
aaacggagggtcctgttttcccaggcccaggtttacgagctggagagacgtttcaagcag
cagaaatacctctccgcccccgagagggaacatttagccagcatgatccacctcaccccg
actcaggtcaaaatctggttccagaaccaccgctacaagatgaagcggcaggccaaagac
aaggctgcgcacgagatgcaacaggagaacggctcttgccagcagcagcagtcccccagg
agggtggcggtgccggtgctggtgaaggatggcaagccctgccaggcgggctccaacacc
cccaccgcagccatccagagccacccgcagcaggcggccacgaccatcacggtggccacc
aatggcaacagcctcggacagcatcagagccatcagacaaacagtgcggggcagtctccc
gacatgggacagcactcggccagcccttcctccctgcagagccaagtctccagtttgtct
cacctgaactcttccacttctgactatggcactgccatgtcctgctccaccttgctatac
ggtaggacctggtga

DBGET integrated database retrieval system